Glycogen synthase 1 (GYS1) (NM_002103) Human Tagged ORF Clone

CAT#: RC200940

Reviews ()
Write a review

GYS1 (Myc-DDK-tagged)-Human glycogen synthase 1 (muscle) (GYS1), transcript variant 1

  View "NM_002103" in other vectors (10)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Glycogen synthase 1 (GYS1) (NM_002103) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GYS1
Synonyms GSY; GYS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200940 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTTTAAACCGCACTTTGTCCATGTCCTCACTGCCAGGACTGGAGGACTGGGAGGATGAATTCGACC
TGGAGAACGCAGTGCTCTTCGAAGTGGCCTGGGAGGTGGCTAACAAGGTGGGTGGCATCTACACGGTGCT
GCAGACGAAGGCGAAGGTGACAGGGGACGAATGGGGCGACAACTACTTCCTGGTGGGGCCGTACACGGAG
CAGGGCGTGAGGACCCAGGTGGAACTGCTGGAGGCCCCCACCCCGGCCCTGAAGAGGACACTGGATTCCA
TGAACAGCAAGGGCTGCAAGGTGTATTTCGGGCGCTGGCTGATCGAGGGAGGCCCTCTGGTGGTGCTCCT
GGACGTGGGTGCCTCAGCTTGGGCCCTGGAGCGCTGGAAGGGAGAGCTCTGGGATACCTGCAACATCGGA
GTGCCGTGGTACGACCGCGAGGCCAACGACGCTGTCCTCTTTGGCTTTCTGACCACCTGGTTCCTGGGTG
AGTTCCTGGCACAGAGTGAGGAGAAGCCACATGTGGTTGCTCACTTCCATGAGTGGTTGGCAGGCGTTGG
ACTCTGCCTGTGTCGTGCCCGGCGACTGCCTGTAGCAACCATCTTCACCACCCATGCCACGCTGCTGGGG
CGCTACCTGTGTGCCGGTGCCGTGGACTTCTACAACAACCTGGAGAACTTCAACGTGGACAAGGAAGCAG
GGGAGAGGCAGATCTACCACCGATACTGCATGGAAAGGGCGGCAGCCCACTGCGCTCACGTCTTCACTAC
TGTGTCCCAGATCACCGCCATCGAGGCACAGCACTTGCTCAAGAGGAAACCAGATATTGTGACCCCCAAT
GGGCTGAATGTGAAGAAGTTTTCTGCCATGCATGAGTTCCAGAACCTCCATGCTCAGAGCAAGGCTCGAA
TCCAGGAGTTTGTGCGGGGCCATTTTTATGGGCATCTGGACTTCAACTTGGACAAGACCTTATACTTCTT
TATCGCCGGCCGCTATGAGTTCTCCAACAAGGGTGCTGACGTCTTCCTGGAGGCATTGGCTCGGCTCAAC
TATCTGCTCAGAGTGAACGGCAGCGAGCAGACAGTGGTTGCCTTCTTCATCATGCCAGCGCGGACCAACA
ATTTCAACGTGGAAACCCTCAAAGGCCAAGCTGTGCGCAAACAGCTTTGGGACACGGCCAACACGGTGAA
GGAAAAGTTCGGGAGGAAGCTTTATGAATCCTTACTGGTTGGGAGCCTTCCCGACATGAACAAGATGCTG
GATAAGGAAGACTTCACTATGATGAAGAGAGCCATCTTTGCAACGCAGCGGCAGTCTTTCCCCCCTGTGT
GCACCCACAATATGCTGGATGACTCCTCAGACCCCATCCTGACCACCATCCGCCGAATCGGCCTCTTCAA
TAGCAGTGCCGACAGGGTGAAGGTGATTTTCCACCCGGAGTTCCTCTCCTCCACAAGCCCCCTGCTCCCT
GTGGACTATGAGGAGTTTGTCCGTGGCTGTCACCTTGGAGTCTTCCCCTCCTACTATGAGCCTTGGGGCT
ACACACCGGCTGAGTGCACGGTTATGGGAATCCCCAGTATCTCCACCAATCTCTCCGGCTTCGGCTGCTT
CATGGAGGAACACATCGCAGACCCCTCAGCTTACGGTATCTACATTCTTGACCGGCGGTTCCGCAGCCTG
GATGATTCCTGCTCGCAGCTCACCTCCTTCCTCTACAGTTTCTGTCAGCAGAGCCGGCGGCAGCGTATCA
TCCAGCGGAACCGCACGGAGCGCCTCTCCGACCTTCTGGACTGGAAATACCTAGGCCGGTACTATATGTC
TGCGCGCCACATGGCGCTGTCCAAGGCCTTTCCAGAGCACTTCACCTACGAGCCCAACGAGGCGGATGCG
GCCCAGGGGTACCGCTACCCACGGCCAGCCTCGGTGCCACCGTCGCCCTCGCTGTCACGACACTCCAGCC
CGCACCAGAGTGAGGACGAGGAGGATCCCCGGAACGGGCCGCTGGAGGAAGACGGCGAGCGCTACGATGA
GGACGAGGAGGCCGCCAAGGACCGGCGCAACATCCGTGCACCAGAGTGGCCGCGCCGAGCGTCCTGCACC
TCCTCCACCAGCGGCAGCAAGCGCAACTCTGTGGACACGGCCACCTCCAGCTCACTCAGCACCCCGAGCG
AGCCCCTCAGCCCCACCAGCTCCCTGGGCGAGGAGCGTAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200940 protein sequence
Red=Cloning site Green=Tags(s)

MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTE
QGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIG
VPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLG
RYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPN
GLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLN
YLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLP
VDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSL
DDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADA
AQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCT
SSTSGSKRNSVDTATSSSLSTPSEPLSPTSSLGEERN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002103
ORF Size 2211 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002103.1, NM_002103.2, NM_002103.3, NM_002103.4, NP_002094.2
RefSeq Size 3635
RefSeq ORF 2214
Locus ID 2997
Cytogenetics 19q13.33
Protein Pathways Insulin signaling pathway, Starch and sucrose metabolism
MW 83.8 kDa
Gene Summary The protein encoded by this gene catalyzes the addition of glucose monomers to the growing glycogen molecule through the formation of alpha-1,4-glycoside linkages. Mutations in this gene are associated with muscle glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Other Versions

Other products for "GYS1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-GYS1 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones