LARP1 (NM_015315) Human Tagged ORF Clone

CAT#: RC200935

Reviews ()
Write a review
  • TrueORF®

LARP1 (Myc-DDK-tagged)-Human La ribonucleoprotein domain family, member 1 (LARP1), transcript variant 1



  "NM_015315" in other vectors (6)

Reconstitution Protocol

USD 887.00

USD 1,330.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "LARP1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LARP1
Synonyms Lar1; LARP; Lhp1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200935 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTTGGAGGGTGCTTTTGTCAAAGAGGCCTCCTTTCCCTCACCCAGAGCTGGATTTCCAAGAGGCTC
CCATACCTAGCTGCCCTGGCAGACTCCCAGGGAGGAAAAACAGCGTGGCCTTGGCAGCTGCCCCGAGGAA
GGAGCCCACAGGTGACAGGGAGAAGCCATTGCCATTCCCTGTCCTGGCCCCCTTCAGCAACCCTGAACAC
TCTGCTCCAGCCAAGGTGGTGAGGGCAGCTGTTCCTAAACAGCGCAAAGGCAGCAAGGTTGGTGACTTTG
GAGATGCAATCAATTGGCCCACACCTGGAGAGATAGCCCACAAGAGTGTTCAGCCACAGTCCCACAAGCC
TCAGCCTACCCGTAAACTGCCACCCAAGAAGGACATGAAGGAACAGGAGAAAGGAGAAGGGAGTGATAGT
AAGGAGAGTCCAAAAACCAAATCAGATGAATCAGGGGAGGAAAAGAATGGAGATGAGGATTGCCAGCGAG
GCGGGCAGAAGAAGAAAGGAAACAAACACAAGTGGGTTCCATTACAAATAGACATGAAGCCTGAAGTGCC
CAGAGAGAAACTGGCTTCACGCCCCACTCGCCCACCGGAGCCTAGACACATACCTGCCAATCGCGGAGAG
ATCAAAGGGTCTGAGTCTGCCACCTACGTGCCCGTGGCCCCCCCCACCCCAGCCTGGCAACCAGAGATCA
AACCGGAGCCTGCCTGGCACGACCAGGATGAGACATCGAGTGTGAAGAGTGATGGGGCTGGTGGGGCGCG
GGCTTCCTTCCGTGGCCGTGGACGGGGGCGTGGTCGCGGCCGGGGACGCGGCCGGGGTGGCACTCGAACC
CATTTTGACTACCAGTTTGGCTACCGAAAGTTTGATGGTGTGGAGGGGCCTCGTACGCCCAAGTACATGA
ACAACATCACCTACTACTTTGACAATGTCAGCAGCACCGAGCTTTACAGTGTGGATCAGGAACTGCTCAA
AGACTACATCAAGCGCCAGATTGAATACTACTTCAGCGTGGACAATTTAGAGCGAGACTTCTTCCTGCGA
AGGAAAATGGATGCTGATGGTTTCCTACCCATCACCCTTATTGCTTCCTTCCACCGAGTGCAGGCCCTTA
CCACTGACATTTCACTCATCTTTGCGGCCCTAAAGGACAGCAAGGTGGTGGAGATCGTTGATGAGAAAGT
TCGTAGGAGGGAGGAACCAGAAAAGTGGCCTCTTCCCCCAATAGTGGATTATTCACAGACTGATTTCTCC
CAGCTTCTCAACTGCCCTGAATTTGTTCCCCGTCAGCACTACCAAAAGGAGACAGAGTCGGCACCTGGCT
CTCCTCGTGCAGTCACCCCAGTGCCAACCAAAACAGAGGAGGTCAGCAACCTAAAGACACTACCCAAGGG
CCTGTCTGCCAGCCTGCCTGACCTGGATTCTGAGAACTGGATTGAAGTGAAGAAGAGGCCTCGGCCATCC
CCAGCACGGCCCAAGAAGTCAGAGGAGTCCAGATTTTCCCACCTGACCTCCCTGCCTCAGCAGCTGCCTT
CCCAGCAGCTGATGTCCAAGGATCAGGATGAGCAAGAGGAACTGGATTTTCTGTTTGACGAGGAGATGGA
GCAGATGGATGGGCGGAAGAACACCTTCACTGCCTGGTCTGATGAGGAATCTGACTATGAGATTGATGAC
AGGGATGTCAACAAGATCCTCATTGTCACCCAGACACCACATTACATGCGCCGGCACCCAGGGGGGGACC
GCACAGGCAACCACACCTCGCGTGCCAAGATGAGCGCCGAACTGGCCAAGGTCATTAATGATGGCCTCTT
CTACTATGAGCAGGACCTGTGGGCTGAAAAGTTTGAACCTGAGTATTCCCAGATCAAGCAAGAAGTCGAG
AACTTCAAAAAGGTCAATATGATCAGCCGGGAGCAGTTTGACACACTGACCCCTGAGCCCCCTGTGGATC
CCAACCAGGAAGTTCCTCCTGGGCCACCTCGGTTCCAGCAAGTTCCTACGGATGCCCTGGCCAACAAGTT
GTTTGGTGCTCCTGAGCCCTCCACCATCGCCCGCTCTCTACCAACCACTGTCCCAGAGTCACCAAACTAC
CGCAACACCAGGACCCCTCGCACTCCCCGGACACCACAGCTCAAAGACTCAAGCCAGACATCACGGTTTT
ACCCAGTGGTGAAAGAAGGACGGACACTGGATGCCAAGATGCCTCGAAAAAGAAAGACAAGACACAGTTC
AAACCCACCCTTGGAGAGCCATGTGGGCTGGGTGATGGATTCCCGTGAGCACAGGCCCCGTACTGCTTCC
ATCAGCTCCAGCCCCTCAGAAGGGACGCCTACAGTTGGCAGCTATGGCTGTACCCCTCAGTCATTGCCCA
AGTTCCAGCATCCTTCCCATGAACTGCTCAAGGAAAATGGCTTCACACAACACGTCTACCATAAGTATCG
TAGGCGCTGCCTTAATGAGCGGAAACGCTTGGGCATTGGCCAGTCTCAGGAGATGAACACACTCTTCCGC
TTCTGGTCCTTCTTCCTCCGAGATCACTTCAACAAAAAGATGTATGAGGAGTTCAAGCAGCTGGCTCTGG
AGGACGCCAAAGAAGGCTACAGATATGGTTTGGAGTGCCTTTTTCGATACTACAGTTATGGCCTGGAAAA
GAAGTTCCGGCTGGACATATTCAAGGATTTTCAGGAGGAAACGGTGAAGGACTATGAAGCTGGCCAACTG
TATGGGCTGGAGAAGTTCTGGGCCTTCTTGAAATATTCCAAAGCCAAAAATTTGGACATTGACCCCAAAC
TGCAAGAATACCTCGGCAAATTCCGACGTCTTGAAGACTTCCGAGTAGATCCCCCCATGGGTGAGGAGGG
CAACCACAAGCGACACTCAGTGGTAGCAGGAGGTGGCGGCGGTGAGGGCAGGAAGCGGTGCCCCTCCCAG
TCTTCCAGCAGGCCTGCTGCCATGATCAGCCAACCCCCTACACCACCCACCGGCCAGCCTGTCCGGGAAG
ATGCCAAATGGACAAGCCAGCACTCGAACACACAGACTTTGGGAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200935 protein sequence
Red=Cloning site Green=Tags(s)

MLWRVLLSKRPPFPHPELDFQEAPIPSCPGRLPGRKNSVALAAAPRKEPTGDREKPLPFPVLAPFSNPEH
SAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDS
KESPKTKSDESGEEKNGDEDCQRGGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGE
IKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGRGRGGTRT
HFDYQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLR
RKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEPEKWPLPPIVDYSQTDFS
QLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSENWIEVKKRPRPS
PARPKKSEESRFSHLTSLPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTFTAWSDEESDYEIDD
RDVNKILIVTQTPHYMRRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYSQIKQEVE
NFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNY
RNTRTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTAS
ISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFR
FWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQL
YGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQ
SSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015315
ORF Size 3057 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015315.2
RefSeq Size 6607 bp
RefSeq ORF 3060 bp
Locus ID 23367
UniProt ID Q6PKG0
Cytogenetics 5q33.2
MW 116.5 kDa
Gene Summary RNA-binding protein that regulates the translation of specific target mRNA species downstream of the mTORC1 complex, in function of growth signals and nutrient availability (PubMed:20430826, PubMed:23711370, PubMed:24532714, PubMed:25940091, PubMed:28650797, PubMed:28673543, PubMed:29244122). Interacts on the one hand with the 3' poly-A tails that are present in all mRNA molecules, and on the other hand with the 7-methylguanosine cap structure of mRNAs containing a 5' terminal oligopyrimidine (5'TOP) motif, which is present in mRNAs encoding ribosomal proteins and several components of the translation machinery (PubMed:23711370, PubMed:25940091, PubMed:28650797, PubMed:29244122, PubMed:26206669, PubMed:28379136). The interaction with the 5' end of mRNAs containing a 5'TOP motif leads to translational repression by preventing the binding of EIF4G1 (PubMed:25940091, PubMed:28650797, PubMed:29244122, PubMed:28379136). When mTORC1 is activated, LARP1 is phosphorylated and dissociates from the 5' untranslated region (UTR) of mRNA (PubMed:25940091, PubMed:28650797). Does not prevent binding of EIF4G1 to mRNAs that lack a 5'TOP motif (PubMed:28379136). Interacts with the free 40S ribosome subunit and with ribosomes, both monosomes and polysomes (PubMed:20430826, PubMed:24532714, PubMed:25940091, PubMed:28673543). Under normal nutrient availability, interacts primarily with the 3' untranslated region (UTR) of mRNAs encoding ribosomal proteins and increases protein synthesis (PubMed:23711370, PubMed:28650797). Associates with actively translating ribosomes and stimulates translation of mRNAs containing a 5'TOP motif, thereby regulating protein synthesis, and as a consequence, cell growth and proliferation (PubMed:20430826, PubMed:24532714). Stabilizes mRNAs species with a 5'TOP motif, which is required to prevent apoptosis (PubMed:20430826, PubMed:23711370, PubMed:25940091, PubMed:28673543).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.