METTL14 (NM_020961) Human Tagged ORF Clone

CAT#: RC200925

Reviews ()
Write a review

METTL14 (Myc-DDK-tagged)-Human methyltransferase like 14 (METTL14)



  "NM_020961" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "METTL14"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol METTL14
Synonyms hMETTL14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200925 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATAGCCGCTTGCAGGAGATCCGGGAGCGGCAGAAGTTACGGCGACAGCTCCTCGCGCAGCAGTTGG
GAGCTGAAAGTGCCGACAGCATTGGTGCCGTGTTAAATAGCAAAGATGAGCAGAGAGAAATTGCTGAAAC
AAGAGAAACTTGCAGGGCTTCCTATGATACCTCTGCTCCAAATGCAAAACGTAAGTATCTGGATGAAGGA
GAGACAGATGAAGACAAAATGGAAGAATATAAGGATGAACTAGAAATGCAACAGGATGAAGAAAATTTGC
CATATGAAGAAGAGATTTACAAAGATTCTAGTACTTTTCTTAAGGGAACACAGAGCTTAAATCCCCATAA
TGATTACTGCCAACATTTTGTAGACACTGGACATAGACCTCAGAATTTCATCAGGGATGTAGGTTTAGCT
GACAGATTTGAAGAATATCCTAAACTGAGGGAGCTCATCAGGCTAAAGGATGAGTTAATAGCTAAATCTA
ACACTCCTCCCATGTACTTACAAGCCGATATAGAAGCCTTTGACATCAGAGAACTAACACCCAAATTTGA
TGTGATTCTTCTGGAACCCCCTTTAGAAGAATATTACAGAGAAACTGGCATCACTGCTAATGAAAAATGC
TGGACTTGGGATGATATTATGAAGTTAGAAATTGATGAGATTGCAGCACCTCGATCATTTATTTTTCTCT
GGTGTGGTTCTGGGGAGGGGTTGGACCTTGGAAGAGTGTGTTTACGAAAATGGGGTTACAGAAGATGTGA
AGATATTTGTTGGATTAAAACCAATAAAAACAATCCTGGGAAGACTAAGACTTTAGATCCAAAGGCTGTC
TTTCAGAGAACAAAGGAACACTGCCTCATGGGGATCAAAGGAACTGTGAAGCGTAGCACAGACGGGGACT
TCATTCATGCTAATGTTGACATTGACTTAATTATCACAGAAGAACCTGAAATTGGCAATATAGAAAAACC
TGTAGAAATTTTTCATATAATTGAGCATTTTTGTCTTGGTAGAAGACGCCTTCATCTATTTGGAAGAGAT
AGTACAATTCGACCAGGCTGGCTCACAGTTGGACCAACGCTTACAAATAGCAACTACAATGCAGAAACAT
ATGCATCCTATTTCAGTGCTCCTAATTCCTACTTGACTGGTTGTACAGAAGAAATTGAGAGACTTCGACC
AAAATCGCCTCCTCCCAAATCTAAATCTGACCGAGGAGGTGGAGCTCCCAGAGGTGGAGGAAGAGGTGGA
ACTTCTGCTGGCCGTGGACGAGAAAGAAATAGATCTAACTTCCGAGGAGAAAGAGGTGGCTTTAGAGGGG
GCCGTGGAGGAGCACACAGAGGTGGCTTTCCACCTCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200925 protein sequence
Red=Cloning site Green=Tags(s)

MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEG
ETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLA
DRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC
WTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAV
FQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRD
STIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG
TSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020961
ORF Size 1368 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020961.4
RefSeq Size 2138 bp
RefSeq ORF 1371 bp
Locus ID 57721
UniProt ID Q9HCE5
Cytogenetics 4q26
Domains MT-A70
MW 52.2 kDa
Gene Summary The METTL3-METTL14 heterodimer forms a N6-methyltransferase complex that methylates adenosine residues at the N(6) position of some mRNAs and regulates the circadian clock, differentiation of embryonic stem cells and cortical neurogenesis (PubMed:24316715, PubMed:24407421, PubMed:25719671, PubMed:29348140, PubMed:27373337, PubMed:27281194). In the heterodimer formed with METTL3, METTL14 constitutes the RNA-binding scaffold that recognizes the substrate rather than the catalytic core (PubMed:27627798, PubMed:27373337, PubMed:27281194, PubMed:29348140). N6-methyladenosine (m6A), which takes place at the 5'-[AG]GAC-3' consensus sites of some mRNAs, plays a role in mRNA stability and processing (PubMed:24316715, PubMed:24407421, PubMed:25719671). M6A acts as a key regulator of mRNA stability by promoting mRNA destabilization and degradation (By similarity). In embryonic stem cells (ESCs), m6A methylation of mRNAs encoding key naive pluripotency-promoting transcripts results in transcript destabilization (By similarity). M6A regulates spermatogonial differentiation and meiosis and is essential for male fertility and spermatogenesis (By similarity). M6A also regulates cortical neurogenesis: m6A methylation of transcripts related to transcription factors, neural stem cells, the cell cycle and neuronal differentiation during brain development promotes their destabilization and decay, promoting differentiation of radial glial cells (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Rabbit Polyclonal Anti-METTL14 Antibody
    • 100 ul

USD 539.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.