USP10 (NM_005153) Human Tagged ORF Clone

CAT#: RC200835

Reviews ()
Write a review

USP10 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 10 (USP10)



  "NM_005153" in other vectors (6)

Reconstitution Protocol

USD 731.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "USP10"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol USP10
Synonyms UBPO
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200835 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCTCCACAGCCCGCAGTATATTTTTGGAGATTTTAGCCCTGATGAATTCAATCAATTCTTTGTGA
CTCCTCGATCTTCAGTTGAGCTTCCTCCATACAGTGGAACAGTTCTGTGTGGCACACAGGCTGTGGATAA
ACTACCTGATGGACAAGAATATCAGAGAATTGAGTTTGGTGTCGATGAAGTCATTGAACCCAGTGACACT
TTGCCGAGAACCCCCAGCTACAGTATTTCAAGCACACTGAACCCTCAGGCCCCTGAATTTATTCTCGGTT
GTACAGCTTCCAAAATAACCCCTGATGGTATCACTAAAGAAGCAAGCTATGGCTCCATCGACTGCCAGTA
CCCAGGCTCTGCCCTCGCTTTGGATGGAAGTTCTAATGTGGAGGCGGAAGTTTTGGAAAATGATGGTGTC
TCAGGTGGTCTTGGACAAAGGGAGCGTAAAAAGAAGAAAAAGCGGCCACCTGGATATTACAGCTATTTGA
AAGATGGTGGCGATGATAGTATCTCCACAGAAGCCCTGGTCAATGGCCATGCCAATTCAGCAGTCCCGAA
CAGTGTCAGTGCAGAGGATGCAGAATTTATGGGTGACATGCCTCCGCCACTTACGCCCAGGACTTGTAAC
AGCCCCCAGAACTCCACAGACTCTGTCAGTGACATTGTGCCTGACAGTCCTTTCCCCGGAGCACTCGGCA
GTGACACCAGGACTGCAGGGCAGCCAGAGGGGGGCCCCGGGGCTGATTTTGGTCAGTCCTGCTTCCCTGC
AGAGGCTGGCAGAGACACCCTGTCAAGGACAGCTGGGGCTCAGCCCTGCGTTGGTACCGATACTACTGAA
AACCTTGGAGTTGCTAATGGACAAATACTTGAATCCTCGGGTGAGGGCACAGCTACCAACGGGGTGGAGT
TGCACACCACGGAAAGCATAGACTTGGACCCAACCAAACCCGAGAGTGCATCACCTCCTGCTGACGGCAC
GGGCTCTGCATCAGGCACCCTTCCTGTCAGCCAGCCCAAGTCCTGGGCCAGCCTCTTTCATGATTCTAAG
CCCTCTTCCTCCTCGCCGGTGGCCTATGTGGAAACTAAGTATTCCCCTCCCGCCATATCTCCCCTGGTTT
CTGAAAAGCAGGTTGAAGTCAAAGAAGGGCTTGTTCCGGTTTCAGAGGATCCTGTAGCCATAAAGATTGC
AGAGTTGCTGGAGAATGTAACCCTAATCCATAAACCAGTGTCGTTGCAACCCCGTGGGCTGATCAATAAA
GGGAACTGGTGCTACATTAATGCTACACTGCAGGCATTGGTTGCTTGCCCGCCGATGTACCACCTGATGA
AGTTCATTCCTCTGTATTCCAAAGTGCAAAGGCCTTGTACGTCAACACCCATGATAGACAGCTTTGTTCG
GCTAATGAATGAGTTCACTAATATGCCAGTACCTCCAAAACCCCGACAAGCTCTTGGAGATAAAATCGTG
AGGGATATTCGCCCTGGAGCTGCCTTTGAGCCCACATATATTTACAGACTCCTGACAGTTAACAAGTCAA
GCCTGTCTGAAAAGGGTCGACAAGAAGATGCTGAGGAATACTTAGGCTTCATTCTAAATGGACTTCATGA
GGAAATGTTGAACCTAAAGAAGCTTCTCTCACCAAGTAATGAAAAACTTACGATTTCCAACGGCCCCAAA
AACCACTCGGTCAATGAAGAAGAGCAGGAAGAACAAGGTGAAGGAAGCGAGGATGAATGGGAACAAGTGG
GCCCCCGGAACAAGACTTCCGTCACCCGCCAGGCGGATTTTGTTCAGACTCCAATCACCGGCATTTTTGG
TGGACACATCAGGTCTGTGGTTTACCAGCAGAGTTCAAAAGAATCTGCCACTTTGCAGCCATTTTTCACG
TTGCAGTTGGATATCCAGTCAGACAAGATACGCACAGTCCAGGATGCACTGGAGAGCTTGGTGGCAAGAG
AATCTGTCCAAGGTTATACCACAAAAACCAAACAAGAGGTTGAGATAAGTCGAAGAGTGACTCTGGAAAA
ACTCCCTCCTGTCCTCGTGCTGCACCTGAAACGATTCGTTTATGAGAAGACTGGTGGGTGCCAGAAGCTT
ATCAAAAATATTGAATATCCTGTGGACTTGGAAATTAGTAAAGAACTGCTTTCTCCAGGGGTTAAAAATA
AGAATTTTAAATGCCACCGAACCTATCGGCTCTTTGCAGTGGTCTACCATCACGGCAACAGTGCGACGGG
CGGCCATTACACTACAGACGTCTTCCAGATCGGTCTGAATGGCTGGCTGCGCATCGATGACCAGACAGTC
AAGGTGATCAACCAGTACCAGGTGGTGAAACCAACTGCTGAACGCACAGCCTACCTCCTGTATTACCGCC
GAGTGGACCTGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200835 protein sequence
Red=Cloning site Green=Tags(s)

MALHSPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDGQEYQRIEFGVDEVIEPSDT
LPRTPSYSISSTLNPQAPEFILGCTASKITPDGITKEASYGSIDCQYPGSALALDGSSNVEAEVLENDGV
SGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPPPLTPRTCN
SPQNSTDSVSDIVPDSPFPGALGSDTRTAGQPEGGPGADFGQSCFPAEAGRDTLSRTAGAQPCVGTDTTE
NLGVANGQILESSGEGTATNGVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSK
PSSSSPVAYVETKYSPPAISPLVSEKQVEVKEGLVPVSEDPVAIKIAELLENVTLIHKPVSLQPRGLINK
GNWCYINATLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDKIV
RDIRPGAAFEPTYIYRLLTVNKSSLSEKGRQEDAEEYLGFILNGLHEEMLNLKKLLSPSNEKLTISNGPK
NHSVNEEEQEEQGEGSEDEWEQVGPRNKTSVTRQADFVQTPITGIFGGHIRSVVYQQSSKESATLQPFFT
LQLDIQSDKIRTVQDALESLVARESVQGYTTKTKQEVEISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKL
IKNIEYPVDLEISKELLSPGVKNKNFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTV
KVINQYQVVKPTAERTAYLLYYRRVDLL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005153
ORF Size 2394 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005153.1, NP_005144.1
RefSeq Size 3399 bp
RefSeq ORF 2397 bp
Locus ID 9100
UniProt ID Q14694
Cytogenetics 16q24.1
Domains UCH
Protein Families Druggable Genome, Protease
MW 87.2 kDa
Gene Summary Ubiquitin is a highly conserved protein that is covalently linked to other proteins to regulate their function and degradation. This gene encodes a member of the ubiquitin-specific protease family of cysteine proteases. The enzyme specifically cleaves ubiquitin from ubiquitin-conjugated protein substrates. The protein is found in the nucleus and cytoplasm. It functions as a co-factor of the DNA-bound androgen receptor complex, and is inhibited by a protein in the Ras-GTPase pathway. The human genome contains several pseudogenes similar to this gene. Several transcript variants, some protein-coding and others not protein-coding, have been found for this gene. [provided by RefSeq, Jan 2013]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.