ALS2CR1 (NIF3L1) (NM_021824) Human Tagged ORF Clone

CAT#: RC200827

Reviews ()
Write a review

NIF3L1 (Myc-DDK-tagged)-Human NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 2



  "NM_021824" in other vectors (4)

Reconstitution Protocol

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Other products for "NIF3L1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NIF3L1
Synonyms ALS2CR1; CALS-7; MDS015
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200827 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGTCATCTTGCGTACGCCCAGTCCCCACGACAGTCCGGTTTGTAGATTCCCTGATCTGCAATTCTT
CCCGTTCCTTCATGGATTTGAAGGCTCTCCTTTCTTCCTTGAATGACTTTGCATCCCTCTCGTTTGCTGA
GAGTTGGGACAATGTTGGATTACTGGTGGAACCAAGCCCACCACATACTGTAAATACACTCTTCCTGACC
AATGACCTGACTGAGGAAGTGATGGAGGAGGTGCTGCAAAAGAAGGCAGACCTCATTCTCTCCTACCATC
CGCCTATCTTCCGACCCATGAAGCGCATAACCTGGAACACATGGAAGGAGCGCCTGGTGATCCGGGCTCT
GGAGAACAGAGTCGGTATCTACTCTCCTCATACAGCCTATGATGCTGCGCCCCAGGGCGTCAACAACTGG
TTGGCTAAAGGGCTTGGAGCTTGTACCTCCAGGCCCATACATCCTTCCAAAGCTCCCAACTACCCTACAG
AGGGAAACCACCGAGTAGAATTCAACGTTAACTACACCCAAGACCTGGACAAAGTCATGTCTGCAGTGAA
AGGAATTGACGGTGTTTCTGTCACTTCTTTTTCTGCTAGGACTGGTAATGAGGAACAAACACGGATTAAT
CTGAATTGTACTCAGAAGGCTTTGATGCAGGTGGTAGATTTTCTTTCCCGGAACAAACAACTTTATCAGA
AGACGGAAATTCTGTCACTGGAGAAGCCTTTGCTTCTACATACTGGAATGGGACGGTTATGCACACTGGA
TGAATCTGTCTCCCTGGCAACCATGATTGATCGAATAAAAAGACACCTAAAACTATCTCATATTCGCTTA
GCCCTTGGGGTGGGGAGAACCTTAGAGTCTCAAGTCAAAGTCGTGGCCCTGTGTGCTGGTTCTGGGAGCA
GCGTTCTGCAGGGTGTTGAGGCTGACCTTTACCTCACAGGTGAGATGTCCCATCATGATACTTTGGATGC
TGCTTCCCAAGGAATAAATGTCATCCTCTGTGAACACAGCAACACTGAACGAGGCTTTCTTTCTGACCTT
CGAGATATGCTGGATTCTCACTTGGAGAATAAGATAAATATTATCCTATCAGAGACTGACAGGGACCCTC
TTCAGGTGGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200827 protein sequence
Red=Cloning site Green=Tags(s)

MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLT
NDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENRVGIYSPHTAYDAAPQGVNNW
LAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEEQTRIN
LNCTQKALMQVVDFLSRNKQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRL
ALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL
RDMLDSHLENKINIILSETDRDPLQVV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021824
ORF Size 1134 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq Size 1649 bp
RefSeq ORF 1053 bp
Locus ID 60491
UniProt ID Q9GZT8
Cytogenetics 2q33.1
Domains NIF3, DUF34
MW 42 kDa
Gene Summary May function as a transcriptional corepressor through its interaction with COPS2, negatively regulating the expression of genes involved in neuronal differentiation.[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.