MTMR14 (NM_022485) Human Tagged ORF Clone

CAT#: RC200809

Reviews ()
Write a review

MTMR14 (Myc-DDK-tagged)-Human myotubularin related protein 14 (MTMR14), transcript variant 3

  View "NM_022485" in other vectors (7)

USD 480.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name MTMR14 (NM_022485) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MTMR14
Synonyms C3orf29
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200809 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGGCGCTCGGGCCGCCGCCGCCGCTGCCTCGGCGGGGTCCTCGGCCTCTTCAGGCAACCAGCCGC
CTCAGGAGCTGGGGCTTGGGGAGCTGCTGGAGGAGTTCTCCCGGACTCAGTACCGGGCCAAGGATGGCAG
CGGGACCGGCGGCTCTAAGGTTGAGCGCATTGAGAAGAGATGTCTGGAGCTGTTTGGCCGAGACTACTGT
TTCAGCGTGATTCCAAACACGAATGGGGATATCTGTGGCCACTATCCCCGGCACATCGTGTTCCTGGAGT
ATGAGAGTTCTGAGAAGGAGAAAGACACGTTTGAGAGTACCGTACAGGTGAGCAAGTTGCAAGACCTCAT
CCACCGCAGCAAGATGGCCCGGTGCAGAGGACGGTTTGTCTGCCCAGTAATCCTGTTCAAGGGCAAGCAC
ATTTGCAGGTCGGCCACACTGGCTGGATGGGGAGAGCTGTATGGACGCTCAGGCTACAACTATTTTTTCT
CAGGGGGTGCAGATGATGCCTGGGCAGATGTGGAGGACGTCACGGAGGAGGACTGTGCTCTTCGAAGTGG
TGACACGCATCTTTTTGATAAGGTCAGAGGCTATGACATCAAGCTGCTTCGATACCTGTCAGTCAAATAC
ATCTGTGACCTGATGGTGGAGAACAAGAAGGTGAAGTTTGGCATGAATGTAACCTCCTCTGAGAAGGTGG
ACAAAGCCCAGCGCTATGCCGACTTCACTCTCCTCTCCATCCCGTATCCAGGCTGTGAATTTTTCAAGGA
ATATAAAGATCGGGATTACATGGCAGAAGGGCTCATATTTAACTGGAAGCAGGACTACGTTGATGCCCCA
TTGAGCATCCCCGACTTCCTGACTCACTCTCTGAACATTGACTGGAGCCAGTATCAGTGTTGGGATCTGG
TGCAACAAACACAAAACTACCTGAAGCTGCTGCTTTCCTTAGTTAACAGTGATGATGACAGCGGGCTGCT
GGTACACTGTATCTCAGGCTGGGATCGGACCCCCCTCTTCATCTCCCTCCTGCGCCTTTCCTTGTGGGCT
GATGGGCTCATCCACACGTCCCTGAAGCCCACTGAGATCCTCTACCTCACTGTGGCCTATGACTGGTTCC
TCTTCGGGCACATGTTGGTAGATCGGCTCAGCAAAGGGGAGGAGATTTTCTTCTTCTGCTTCAATTTTTT
GAAGCATATTACCTCCGAGGAGTTCTCTGCTCTGAAGACCCAGAGGAGGAAGAGTTTGCCAGCCCGGGAT
GGAGGCTTCACCCTGGAAGACATCTGCATGCTGAGACGAAAGGACCGTGGCAGCACCACCAGCCTTGGCA
GCGACTTCTCCCTGGTCATGGAGAGTTCCCCAGGAGCCACTGGGAGCTTCACCTATGAGGCCGTGGAGCT
GGTCCCAGCAGGAGCGCCAACTCAGGCAGCTTGGCTTGCAGCCCTGAGTGATCGAGAGACTCGGCTGCAG
GAGGTGCGCTCAGCCTTCTTGGCTGCGTACAGCAGCACAGTGGGGCTTCGGGCAGTAGCCCCCAGTCCTT
CCGGTGCCATCGGGGGCCTGCTGGAGCAATTTGCCCGTGGTGTTGGACTCCGGAGCATCAGCAGCAATGC
CTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200809 protein sequence
Red=Cloning site Green=Tags(s)

MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKRCLELFGRDYC
FSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRSKMARCRGRFVCPVILFKGKH
ICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEEDCALRSGDTHLFDKVRGYDIKLLRYLSVKY
ICDLMVENKKVKFGMNVTSSEKVDKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAP
LSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWA
DGLIHTSLKPTEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD
GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWLAALSDRETRLQ
EVRSAFLAAYSSTVGLRAVAPSPSGAIGGLLEQFARGVGLRSISSNAL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_022485
ORF Size 1614 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_022485.3, NM_022485.4, NP_071930.2
RefSeq Size 2200
RefSeq ORF 1617
Locus ID 64419
Cytogenetics 3p25.3
Protein Families Druggable Genome, Phosphatase, Secreted Protein
MW 60 kDa
Gene Summary This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18. [provided by RefSeq, Apr 2010]

Other Versions

Other products for "MTMR14"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Anti-MTMR14 mouse monoclonal antibody, clone OTI6B6 (formerly 6B6)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones