ALDH1A1 (NM_000689) Human Tagged ORF Clone

CAT#: RC200723

ALDH1A1 (Myc-DDK-tagged)-Human aldehyde dehydrogenase 1 family, member A1 (ALDH1A1)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ALDH1A1 (NM_000689) Human Tagged ORF Clone
Symbol ALDH1A1
Synonyms ALDC; ALDH-E1; ALDH1; ALDH11; HEL-9; HEL-S-53e; HEL12; PUMB1; RALDH1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200723 representing NM_000689
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCATCCTCAGGCACGCCAGACTTACCTGTCCTACTCACCGATTTGAAGATTCAATATACTAAGATCT
TCATAAACAATGAATGGCATGATTCAGTGAGTGGCAAGAAATTTCCTGTCTTTAATCCTGCAACTGAGGA
GGAGCTCTGCCAGGTAGAAGAAGGAGATAAGGAGGATGTTGACAAGGCAGTGAAGGCCGCAAGACAGGCT
TTTCAGATTGGATCCCCGTGGCGTACTATGGATGCTTCCGAGAGGGGGCGACTATTATACAAGTTGGCTG
ATTTAATCGAAAGAGATCGTCTGCTGCTGGCGACAATGGAGTCAATGAATGGTGGAAAACTCTATTCCAA
TGCATATCTGAATGATTTAGCAGGCTGCATCAAAACATTGCGCTACTGTGCAGGTTGGGCTGACAAGATC
CAGGGCCGTACAATACCAATTGATGGAAATTTTTTTACATATACAAGACATGAACCTATTGGTGTATGTG
GCCAAATCATTCCTTGGAATTTCCCGTTGGTTATGCTCATTTGGAAGATAGGGCCTGCACTGAGCTGTGG
AAACACAGTGGTTGTCAAACCAGCAGAGCAAACTCCTCTCACTGCTCTCCACGTGGCATCTTTAATAAAA
GAGGCAGGGTTTCCTCCTGGAGTAGTGAATATTGTTCCTGGTTATGGGCCTACAGCAGGGGCAGCCATTT
CTTCTCACATGGATATAGACAAAGTAGCCTTCACAGGATCAACAGAGGTTGGCAAGTTGATCAAAGAAGC
TGCCGGGAAAAGCAATCTGAAGAGGGTGACCCTGGAGCTTGGAGGAAAGAGCCCTTGCATTGTGTTAGCT
GATGCCGACTTGGACAATGCTGTTGAATTTGCACACCATGGGGTATTCTACCACCAGGGCCAGTGTTGTA
TAGCCGCATCCAGGATTTTTGTGGAAGAATCAATTTATGATGAGTTTGTTCGAAGGAGTGTTGAGCGGGC
TAAGAAGTATATCCTTGGAAATCCTCTGACCCCAGGAGTCACTCAAGGCCCTCAGATTGACAAGGAACAA
TATGATAAAATACTTGACCTCATTGAGAGTGGGAAGAAAGAAGGGGCCAAACTGGAATGTGGAGGAGGCC
CGTGGGGGAATAAAGGCTACTTTGTCCAGCCCACAGTGTTCTCTAATGTTACAGATGAGATGCGCATTGC
CAAAGAGGAGATTTTTGGACCAGTGCAGCAAATCATGAAGTTTAAATCTTTAGATGACGTGATCAAAAGA
GCAAACAATACTTTCTATGGCTTATCAGCAGGAGTGTTTACCAAAGACATTGATAAAGCCATAACAATCT
CCTCTGCTCTGCAGGCAGGAACAGTGTGGGTGAATTGCTATGGCGTGGTAAGTGCCCAGTGCCCCTTTGG
TGGATTCAAGATGTCTGGAAATGGAAGAGAACTGGGAGAGTACGGTTTCCATGAATATACAGAGGTCAAA
ACAGTCACAGTGAAAATCTCTCAGAAGAACTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200723 representing NM_000689
Red=Cloning site Green=Tags(s)

MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQA
FQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKI
QGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIK
EAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLA
DADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVK
TVTVKISQKNS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000689
ORF Size 1503 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000689.1, NM_000689.2, NM_000689.3, NM_000689.4, NP_000680
RefSeq Size 2116
RefSeq ORF 1506
Locus ID 216
Cytogenetics 9q21.13
Domains aldedh
Protein Families ES Cell Differentiation/IPS, Druggable Genome
Protein Pathways Retinol metabolism, Metabolic pathways
MW 54.7 kDa
Gene Summary The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet. [provided by RefSeq, Mar 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)