PFKP (NM_002627) Human Tagged ORF Clone

CAT#: RC200673

Reviews ()
Write a review

PFKP (Myc-DDK-tagged)-Human phosphofructokinase, platelet (PFKP), transcript variant 1



Reconstitution Protocol

USD 718.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PFKP"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PFKP
Synonyms ATP-PFK; PFK-C; PFK-P; PFKF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200673 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCGGACGACTCCCGGGCCCCCAAGGGCTCCTTGCGGAAGTTCCTGGAGCACCTCTCCGGGGCCG
GCAAGGCCATCGGCGTGCTGACCAGCGGCGGGGATGCTCAAGGTATGAACGCTGCCGTCCGTGCCGTGGT
GCGCATGGGTATCTACGTGGGGGCCAAGGTGTACTTCATCTACGAGGGCTACCAGGGCATGGTGGACGGA
GGCTCAAACATCGCAGAGGCCGACTGGGAGAGTGTCTCCAGCATCCTGCAAGTGGGCGGGACGATCATTG
GCAGTGCGCGGTGCCAGGCCTTCCGCACGCGGGAAGGCCGCCTGAAGGCTGCTTGCAACCTGCTGCAGCG
CGGCATCACCAACCTGTGTGTGATCGGCGGGGACGGGAGCCTCACCGGGGCCAACCTCTTCCGGAAGGAG
TGGAGTGGGCTGCTGGAGGAGCTGGCCAGGAACGGCCAGATCGATAAGGAGGCCGTGCAGAAGTACGCCT
ACCTCAACGTGGTGGGCATGGTGGGCTCCATCGACAATGATTTCTGCGGCACCGACATGACCATCGGCAC
GGACTCCGCCCTGCACAGGATCATCGAGGTCGTCGACGCCATCATGACCACGGCCCAGAGCCACCAGAGG
ACCTTCGTTCTGGAGGTGATGGGACGACACTGTGGGTACCTGGCCCTGGTGAGTGCCTTGGCCTGCGGTG
CGGACTGGGTGTTCCTTCCAGAATCTCCACCAGAGGAAGGCTGGGAGGAGCAGATGTGTGTCAAACTCTC
GGAGAACCGTGCCCGGAAAAAAAGGCTGAATATTATTATTGTGGCTGAAGGAGCAATTGATACCCAAAAT
AAACCCATCACCTCTGAGAAAATCAAAGAGCTTGTCGTCACGCAGCTGGGCTATGACACACGTGTGACCA
TCCTCGGGCACGTGCAGAGAGGAGGGACCCCTTCGGCATTCGACAGGATCTTGGCCAGCCGCATGGGAGT
GGAGGCAGTCATCGCCTTGCTAGAGGCCACCCCGGACACCCCAGCTTGCGTCGTGTCACTGAACGGGAAC
CACGCCGTGCGCCTGCCGCTGATGGAGTGCGTGCAGATGACTCAGGATGTGCAGAAGGCGATGGACGAGA
GGAGATTTCAAGATGCGGTTCGACTCCGAGGGAGGAGCTTTGCGGGCAACCTGAACACCTACAAGCGACT
TGCCATCAAGCTGCCGGATGATCAGATCCCAAAGACCAATTGCAACGTAGCTGTCATCAACGTGGGGGCA
CCCGCGGCTGGGATGAACGCGGCCGTACGCTCAGCTGTGCGCGTGGGCATTGCCGACGGCCACAGGATGC
TCGCCATCTATGATGGCTTTGACGGCTTCGCCAAGGGCCAGATCAAAGAAATCGGCTGGACAGATGTCGG
GGGCTGGACCGGCCAAGGAGGCTCCATTCTTGGGACAAAACGCGTTCTCCCGGGGAAGTACTTGGAAGAG
ATCGCCACACAGATGCGCACGCACAGCATCAACGCGCTGCTGATCATCGGTGGATTCGAGGCCTACCTGG
GACTCCTGGAGCTGTCAGCCGCCCGGGAGAAGCACGAGGAGTTCTGTGTCCCCATGGTCATGGTTCCCGC
TACTGTGTCCAACAATGTGCCGGGTTCCGATTTCAGCATCGGGGCAGACACCGCCCTGAACACTATCACC
GACACCTGCGACCGCATCAAGCAGTCCGCCAGCGGAACCAAGCGGCGCGTGTTCATCATCGAGACCATGG
GCGGCTACTGTGGCTACCTGGCCAACATGGGGGGGCTCGCGGCCGGAGCTGATGCCGCATACATTTTCGA
AGAGCCCTTCGACATCAGGGATCTGCAGTCCAACGTGGAGCACCTGACGGAGAAAATGAAGACCACCATC
CAGAGAGGCCTTGTGCTCAGAAATGAGAGCTGCAGTGAAAACTACACCACCGACTTCATTTACCAGCTGT
ATTCAGAAGAGGGCAAAGGCGTGTTTGACTGCAGGAAGAACGTGCTGGGTCACATGCAGCAGGGTGGGGC
ACCCTCTCCATTTGATAGAAACTTTGGAACCAAAATCTCTGCCAGAGCTATGGAGTGGATCACTGCAAAA
CTCAAGGAGGCCCGGGGCAGAGGAAAAAAATTTACCACCGATGATTCCATTTGTGTGCTGGGAATAAGCA
AAAGAAACGTTATTTTTCAACCTGTGGCAGAGCTGAAGAAGCAAACGGATTTTGAGCACAGGATTCCCAA
AGAACAGTGGTGGCTCAAGCTACGGCCCCTCATGAAAATCCTGGCCAAGTACAAGGCCAGCTATGACGTG
TCGGACTCAGGCCAGCTGGAACATGTGCAGCCCTGGAGTGTC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC200673 protein sequence
Red=Cloning site Green=Tags(s)

MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDG
GSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKE
WSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQR
TFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQN
KPITSEKIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGN
HAVRLPLMECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKRVLPGKYLEE
IATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTIT
DTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQSNVEHLTEKMKTTI
QRGLVLRNESCSENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAK
LKEARGRGKKFTTDDSICVLGISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDV
SDSGQLEHVQPWSV

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002627
ORF Size 2352 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002627.1
RefSeq Size 2657 bp
RefSeq ORF 2355 bp
Locus ID 5214
UniProt ID Q01813
Cytogenetics 10p15.2
Domains PFK
Protein Families Druggable Genome
Protein Pathways Fructose and mannose metabolism, Galactose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway
MW 85.6 kDa
Gene Summary This gene encodes a member of the phosphofructokinase A protein family. The encoded enzyme is the platelet-specific isoform of phosphofructokinase and plays a key role in glycolysis regulation. This gene may play a role in metabolic reprogramming in some cancers, including clear cell renal cell carcinomas, and cancer of the bladder, breast, and lung. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.