Caspase 2(CASP2) (NM_032982) Human Tagged ORF Clone

CAT#: RC200669

CASP2 (Myc-DDK-tagged)-Human caspase 2, apoptosis-related cysteine peptidase (CASP2), transcript variant 1

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Caspase 2(CASP2) (NM_032982) Human Tagged ORF Clone
Symbol CASP2
Synonyms CASP-2; ICH1; NEDD-2; NEDD2; PPP1R57
Vector pCMV6-Entry
Sequence Data
>RC200669 representing NM_032982
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGCCGAGCGCGGGGTCTTGGTCCACCTTCCAGCACAAGGAGCTGATGGCCGCTGACAGGGGAC
GCAGGATATTGGGAGTGTGTGGCATGCATCCTCATCATCAGGAAACTCTAAAAAAGAACCGAGTGGTGCT
AGCCAAACAGCTGTTGTTGAGCGAATTATTAGAACATCTTCTGGAGAAGGACATCATCACCTTGGAAATG
AGGGAGCTCATCCAGGCCAAAGTGGGCAGTTTCAGCCAGAATGTGGAACTCCTCAACTTGCTGCCTAAGA
GGGGTCCCCAAGCTTTTGATGCCTTCTGTGAAGCACTGAGGGAGACCAAGCAAGGCCACCTGGAGGATAT
GTTGCTCACCACCCTTTCTGGGCTTCAGCATGTACTCCCACCGTTGAGCTGTGACTACGACTTGAGTCTC
CCTTTTCCGGTGTGTGAGTCCTGTCCCCTTTACAAGAAGCTCCGCCTGTCGACAGATACTGTGGAACACT
CCCTAGACAATAAAGATGGTCCTCTCTGCCTTCAGGTGAAGCCTTGCACTCCTGAATTTTATCAAACACA
CTTCCAGCTGGCATATAGGTTGCAGTCTCGGCCTCGTGGCCTAGCACTGGTGTTGAGCAATGTGCACTTC
ACTGGAGAGAAAGAACTGGAATTTCGCTCTGGAGGGGATGTGGACCACAGTACTCTAGTCACCCTCTTCA
AGCTTTTGGGCTATGACGTCCATGTTCTATGTGACCAGACTGCACAGGAAATGCAAGAGAAACTGCAGAA
TTTTGCACAGTTACCTGCACACCGAGTCACGGACTCCTGCATCGTGGCACTCCTCTCGCATGGTGTGGAG
GGCGCCATCTATGGTGTGGATGGGAAACTGCTCCAGCTCCAAGAGGTTTTTCAGCTCTTTGACAACGCCA
ACTGCCCAAGCCTACAGAACAAACCAAAAATGTTCTTCATCCAGGCCTGCCGTGGAGATGAGACTGATCG
TGGGGTTGACCAACAAGATGGAAAGAACCACGCAGGATCCCCTGGGTGCGAGGAGAGTGATGCCGGTAAA
GAAAAGTTGCCGAAGATGAGACTGCCCACGCGCTCAGACATGATATGCGGCTATGCCTGCCTCAAAGGGA
CTGCCGCCATGCGGAACACCAAACGAGGTTCCTGGTACATCGAGGCTCTTGCTCAAGTGTTTTCTGAGCG
GGCTTGTGATATGCACGTGGCCGACATGCTGGTTAAGGTGAACGCACTTATCAAGGATCGGGAAGGTTAT
GCTCCTGGCACAGAATTCCACCGGTGCAAGGAGATGTCTGAATACTGCAGCACTCTGTGCCGCCACCTCT
ACCTGTTCCCAGGACACCCTCCCACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200669 representing NM_032982
Red=Cloning site Green=Tags(s)

MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEM
RELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSL
PFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHF
TGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVE
GAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGK
EKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGY
APGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032982
ORF Size 1356 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_032982.2, NM_032982.3, NP_116764
RefSeq Size 4145
RefSeq ORF 1359
Locus ID 835
Cytogenetics 7q34
Domains CARD, CASc, ICE_p10, ICE_p20
Protein Families Protease, Druggable Genome
MW 50.5 kDa
Gene Summary Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)