KPNB1 (NM_002265) Human Tagged ORF Clone

CAT#: RC200659

Reviews ()
Write a review
  • TrueORF®

KPNB1 (Myc-DDK-tagged)-Human karyopherin (importin) beta 1 (KPNB1)



  "NM_002265" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,203.00

USD 1,804.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "KPNB1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KPNB1
Synonyms IMB1; Impnb; IPO1; IPOB; NTF97
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200659 representing NM_002265
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGATCACCATTCTCGAGAAGACCGTGTCTCCCGATCGGCTGGAGCTGGAAGCGGCGCAGAAGT
TCCTGGAGCGTGCGGCCGTGGAGAACCTGCCCACTTTCCTTGTGGAACTGTCCAGAGTGCTGGCAAATCC
AGGAAACAGTCAGGTTGCCAGAGTTGCAGCTGGTCTACAAATCAAGAACTCTTTGACATCTAAAGATCCA
GATATCAAGGCACAATATCAGCAGAGGTGGCTTGCTATTGATGCTAATGCTCGACGAGAAGTCAAGAACT
ATGTTTTGCAGACATTGGGTACAGAAACTTACCGGCCTAGTTCTGCCTCACAGTGTGTGGCTGGTATTGC
TTGTGCAGAGATCCCAGTAAACCAGTGGCCAGAACTCATTCCTCAGCTGGTGGCCAATGTCACAAACCCC
AACAGCACAGAGCACATGAAGGAGTCGACATTGGAAGCCATCGGTTATATTTGCCAAGATATAGACCCAG
AGCAGCTACAAGATAAATCCAATGAGATTCTGACTGCCATAATCCAGGGGATGAGGAAAGAAGAGCCTAG
TAATAATGTGAAGCTAGCTGCTACGAATGCACTCCTGAACTCATTGGAGTTCACCAAAGCAAACTTTGAT
AAAGAGTCTGAAAGGCACTTTATTATGCAGGTGGTCTGTGAAGCCACACAGTGTCCAGATACGAGGGTAC
GAGTGGCTGCTTTACAGAATCTGGTGAAGATAATGTCCTTATATTATCAGTACATGGAGACATATATGGG
TCCTGCTCTTTTTGCAATCACAATCGAAGCAATGAAAAGTGACATTGATGAGGTGGCTTTACAAGGGATA
GAATTCTGGTCCAATGTCTGTGATGAGGAAATGGATTTGGCCATTGAAGCTTCAGAGGCAGCAGAACAAG
GACGGCCCCCTGAGCACACCAGCAAGTTTTATGCGAAGGGAGCACTACAGTATCTGGTTCCAATCCTCAC
ACAGACACTAACTAAACAGGACGAAAATGATGATGACGATGACTGGAACCCCTGCAAAGCAGCAGGGGTG
TGCCTCATGCTTCTGGCCACCTGCTGTGAAGATGACATTGTCCCACATGTCCTCCCCTTCATTAAAGAAC
ACATCAAGAACCCAGATTGGCGGTACCGGGATGCAGCAGTGATGGCTTTTGGTTGTATCTTGGAAGGACC
AGAGCCCAGTCAGCTCAAACCACTAGTTATACAGGCTATGCCCACCCTAATAGAATTAATGAAAGACCCC
AGTGTAGTTGTTCGAGATACAGCTGCATGGACTGTAGGCAGAATTTGTGAGCTGCTTCCTGAAGCTGCCA
TCAATGATGTCTACTTGGCTCCCCTGCTACAGTGTCTGATTGAGGGTCTCAGTGCTGAACCCAGAGTGGC
TTCAAATGTGTGCTGGGCTTTCTCCAGTCTGGCTGAAGCTGCTTATGAAGCTGCAGACGTTGCTGATGAT
CAGGAAGAACCAGCTACTTACTGCTTATCTTCTTCATTTGAACTCATAGTTCAGAAGCTCCTAGAGACTA
CAGACAGACCTGATGGACACCAGAACAACCTGAGGAGTTCTGCATATGAATCTCTGATGGAAATTGTGAA
AAACAGTGCCAAGGATTGTTATCCTGCTGTCCAGAAAACGACTTTGGTCATCATGGAACGACTGCAACAG
GTTCTTCAGATGGAGTCACATATCCAGAGCACATCCGATAGAATCCAGTTCAATGACCTTCAGTCTTTAC
TCTGTGCAACTCTTCAGAATGTTCTTCGGAAAGTGCAACATCAAGATGCTTTGCAGATCTCTGATGTGGT
TATGGCCTCCCTGTTAAGGATGTTCCAAAGCACAGCTGGGTCTGGGGGAGTACAAGAGGATGCCCTGATG
GCAGTTAGCACACTGGTGGAAGTGTTGGGTGGTGAATTCCTCAAGTACATGGAGGCCTTTAAACCCTTCC
TGGGCATTGGATTAAAAAATTATGCTGAATACCAGGTTTGTTTGGCAGCTGTGGGCTTAGTGGGAGACTT
GTGCCGTGCCCTGCAATCCAACATCATACCTTTCTGTGACGAGGTGATGCAGCTGCTTCTGGAAAATTTG
GGGAATGAGAACGTCCACAGGTCTGTGAAGCCGCAGATTCTGTCAGTGTTTGGTGATATTGCCCTTGCTA
TTGGAGGAGAGTTTAAAAAATACTTAGAGGTTGTATTGAATACTCTTCAGCAGGCCTCCCAAGCCCAGGT
GGACAAGTCAGACTATGACATGGTGGATTATCTGAATGAGCTAAGGGAAAGCTGCTTGGAAGCCTATACT
GGAATCGTCCAGGGATTAAAGGGGGATCAGGAGAACGTACACCCGGATGTGATGCTGGTACAACCCAGAG
TAGAATTTATTCTGTCTTTCATTGACCACATTGCTGGAGATGAGGATCACACAGATGGAGTAGTAGCTTG
TGCTGCTGGACTAATAGGGGACTTATGTACAGCATTTGGGAAGGATGTACTGAAATTAGTAGAAGCTAGG
CCAATGATCCATGAATTGTTAACTGAAGGGCGGAGATCGAAGACTAACAAAGCAAAAACCCTTGCTACAT
GGGCAACAAAAGAACTGAGGAAACTGAAGAACCAAGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200659 representing NM_002265
Red=Cloning site Green=Tags(s)

MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQIKNSLTSKDP
DIKAQYQQRWLAIDANARREVKNYVLQTLGTETYRPSSASQCVAGIACAEIPVNQWPELIPQLVANVTNP
NSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLAATNALLNSLEFTKANFD
KESERHFIMQVVCEATQCPDTRVRVAALQNLVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGI
EFWSNVCDEEMDLAIEASEAAEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGV
CLMLLATCCEDDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDP
SVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADD
QEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQ
VLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLLRMFQSTAGSGGVQEDALM
AVSTLVEVLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENL
GNENVHRSVKPQILSVFGDIALAIGGEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYT
GIVQGLKGDQENVHPDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEAR
PMIHELLTEGRRSKTNKAKTLATWATKELRKLKNQA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002265
ORF Size 2628 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002265.6
RefSeq Size 4205 bp
RefSeq ORF 2631 bp
Locus ID 3837
UniProt ID Q14974
Cytogenetics 17q21.32
Domains Armadillo_seg, IBN_NT
Protein Families Druggable Genome, Stem cell - Pluripotency
MW 97 kDa
Gene Summary Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2013]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.