Citrate transport protein (SLC25A1) (NM_005984) Human Tagged ORF Clone

CAT#: RC200657

SLC25A1 (Myc-DDK-tagged)-Human solute carrier family 25 (mitochondrial carrier, citrate transporter), member 1 (SLC25A1), nuclear gene encoding mitochondrial protein, transcript variant 1

Product Images

Circular map for RC200657

• 

  Western blot validation of overexpression lysate (Cat# LY416934) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200657 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Citrate transport protein
• Synonyms: CMS23; CTP; D2L2AD; SEA; SLC20A3
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200657 representing NM_005984
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCCGCGCCCCGCGCCCCGCGCGCTCTGGCGGCCGCCGCGCCCGCGTCCGGGAAGGCCAAGCTGACGC
  ACCCGGGGAAGGCGATCCTGGCAGGCGGCCTGGCGGGTGGCATCGAGATCTGCATCACCTTCCCCACCGA
  GTACGTGAAGACGCAGCTGCAGCTGGACGAGCGCTCGCACCCGCCGCGGTACCGGGGCATCGGGGACTGC
  GTGCGGCAGACGGTTCGCAGCCATGGCGTCCTGGGCCTGTACCGCGGCCTTAGCTCCCTGCTCTACGGTT
  CCATCCCCAAGGCGGCCGTCAGGTTTGGAATGTTCGAGTTCCTCAGCAACCACATGCGGGATGCCCAGGG
  ACGGCTGGACAGCACGCGTGGGCTGCTGTGCGGCCTGGGCGCTGGCGTGGCCGAGGCCGTGGTGGTCGTG
  TGCCCCATGGAGACCATCAAGGTGAAGTTCATCCACGACCAGACCTCCCCAAACCCCAAGTACAGAGGAT
  TCTTCCACGGGGTTAGGGAGATTGTGCGGGAACAAGGGCTGAAGGGGACGTACCAGGGCCTCACAGCCAC
  TGTCCTGAAGCAGGGCTCGAACCAGGCCATCCGCTTCTTCGTCATGACCTCCCTGCGCAACTGGTACCGA
  GGGGACAACCCCAACAAGCCCATGAACCCTCTGATCACTGGGGTCTTCGGAGCTATTGCAGGCGCAGCCA
  GTGTCTTTGGAAACACTCCTCTGGATGTGATTAAGACCCGGATGCAGGGCCTGGAGGCGCACAAATACCG
  GAACACGTGGGACTGCGGCTTGCAGATCCTGAAGAAGGAGGGGCTCAAGGCATTCTACAAGGGCACTGTC
  CCCCGCCTGGGCCGGGTCTGCCTGGATGTGGCCATAGTGTTTGTCATCTATGATGAAGTGGTGAAGCTGC
  TCAACAAAGTGTGGAAGACGGAC
  
  CTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATTACAAGGATGACGACG
  ATAAGGTTTAA
  Protein Sequence

  >RC200657 representing NM_005984
  Red=Cloning site Green=Tags(s)
  
  MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDC
  VRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVV
  CPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYR
  GDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTV
  PRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD
  
  LEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-XhoI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_005984
• ORF Size: 933 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
• Note: Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required.

Reference Data

• RefSeq: NM_005984.5
• RefSeq Size: 1619 bp
• RefSeq ORF: 936 bp
• Locus ID: 6576
• UniProt ID: P53007
• Cytogenetics: 22q11.21
• Domains: mito_carr
• Protein Families: Druggable Genome
• MW: 34.01 kDa
• Gene Summary: This gene encodes a member of the mitochondrial carrier subfamily of solute carrier proteins. Members of this family include nuclear-encoded transporters that translocate small metabolites across the mitochondrial membrane. This protein regulates the movement of citrate across the inner membranes of the mitochondria. Mutations in this gene have been associated with combined D-2- and L-2-hydroxyglutaric aciduria. Pseudogenes of this gene have been identified on chromosomes 7, 11, 16, and 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]