Aldehyde dehydrogenase 10 (ALDH3A2) (NM_001031806) Human Tagged ORF Clone

CAT#: RC200648

Reviews ()
Write a review

ALDH3A2 (Myc-DDK-tagged)-Human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1


 Cited in 1 publication.

  "NM_001031806" in other vectors (6)

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Aldehyde dehydrogenase 10 (ALDH3A2) (NM_001031806) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ALDH3A2
Synonyms ALDH10; FALDH; SLS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200648 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTCGAAGTCCGGCGGGTCCGACAGGCGTTCCTGTCCGGCCGGTCGCGACCTCTGCGGTTTCGGC
TGCAGCAGCTGGAGGCCCTGCGGAGGATGGTGCAGGAGCGCGAGAAGGATATCCTGACGGCCATCGCCGC
CGACCTGTGCAAGAGTGAATTCAATGTGTACAGTCAGGAAGTCATTACTGTCCTTGGGGAAATTGATTTT
ATGCTTGAGAATCTTCCTGAATGGGTTACTGCTAAACCAGTTAAGAAGAACGTGCTCACCATGCTGGATG
AGGCCTATATTCAGCCACAGCCTCTGGGAGTGGTGCTGATAATCGGAGCTTGGAATTACCCCTTCGTTCT
CACCATTCAGCCACTGATAGGAGCCATCGCTGCAGGAAATGCTGTGATTATAAAGCCTTCTGAACTGAGT
GAAAATACAGCCAAGATCTTGGCAAAGCTTCTCCCTCAGTATTTAGACCAGGATCTCTATATTGTTATTA
ATGGTGGTGTTGAGGAAACCACGGAGCTCCTGAAGCAGCGATTTGACCACATTTTCTATACGGGAAACAC
TGCGGTTGGCAAAATTGTCATGGAAGCTGCTGCCAAGCATCTGACCCCTGTGACTCTTGAACTGGGAGGG
AAAAGTCCATGTTATATTGATAAAGATTGTGACCTGGACATTGTTTGCAGACGCATAACCTGGGGAAAAT
ACATGAATTGTGGCCAAACCTGCATTGCACCCGACTATATTCTCTGTGAAGCATCCCTCCAAAATCAAAT
TGTATGGAAGATTAAGGAAACAGTGAAGGAATTTTATGGAGAAAATATAAAAGAGTCTCCTGATTATGAA
AGGATCATCAATCTTCGTCATTTTAAGAGGATACTAAGTTTGCTTGAAGGACAAAAGATAGCTTTTGGTG
GGGAGACTGATGAGGCCACACGCTACATAGCCCCAACAGTACTTACCGATGTTGATCCTAAAACCAAGGT
GATGCAAGAAGAAATTTTTGGACCAATTCTTCCAATAGTGCCTGTGAAAAATGTAGATGAGGCCATAAAT
TTCATAAATGAACGTGAAAAGCCTCTGGCTCTTTATGTATTTTCGCATAACCATAAGCTCATCAAACGGA
TGATTGATGAGACATCCAGTGGAGGTGTCACAGGCAATGACGTCATTATGCACTTCACGCTCAACTCTTT
CCCATTTGGAGGAGTGGGTTCCAGTGGGATGGGAGCTTATCACGGAAAACATAGTTTTGATACTTTTTCT
CATCAGCGTCCCTGTTTATTAAAAAGTTTAAAGAGAGAAGGTGCTAACAAACTCAGATATCCTCCCAACA
GCCAGTCAAAGGTGGATTGGGGAAAATTTTTTCTCTTGAAACGGTTCAACAAAGAAAAACTCGGTCTCCT
GTTGCTCACTTTCCTGGGTATTGTAGCCGCTGTGCTTGTCAAGAAATACCAAGCTGTGCTGAGGAGAAAG
GCCCTGTTGATTTTTCTGGTAGTTCACAGACTGCGTTGGTCCAGTAAGCAGAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200648 protein sequence
Red=Cloning site Green=Tags(s)

MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDF
MLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELS
ENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGG
KSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYE
RIINLRHFKRILSLLEGQKIAFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAIN
FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLVKKYQAVLRRK
ALLIFLVVHRLRWSSKQR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001031806
ORF Size 1524 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001031806.1, NP_001026976.1
RefSeq Size 3823
RefSeq ORF 1527
Locus ID 224
Cytogenetics 17p11.2
Protein Families Druggable Genome, Transmembrane
Protein Pathways Arginine and proline metabolism, Ascorbate and aldarate metabolism, beta-Alanine metabolism, Butanoate metabolism, Fatty acid metabolism, Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Histidine metabolism, Limonene and pinene degradation, Lysine degradation, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism, Tryptophan metabolism, Valine, leucine and isoleucine degradation
MW 57.7 kDa
Gene Summary Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "ALDH3A2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools