DUSP4 (NM_001394) Human Tagged ORF Clone

CAT#: RC200640

Reviews ()
Write a review

DUSP4 (Myc-DDK-tagged)-Human dual specificity phosphatase 4 (DUSP4), transcript variant 1


Product Datasheet for 'RC200640'


 Cited in 1 publication.

  "NM_001394" in other vectors (6)

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name DUSP4 (NM_001394) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DUSP4
Synonyms HVH2; MKP-2; MKP2; TYP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200640 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGACGATGGAGGAGCTGCGGGAGATGGACTGCAGTGTGCTCAAAAGGCTGATGAACCGGGACGAGA
ATGGCGGCGGCGCGGGCGGCAGCGGCAGCCACGGCACCCTGGGGCTGCCGAGCGGCGGCAAGTGCCTGCT
GCTGGACTGCAGACCGTTCCTGGCGCACAGCGCGGGCTACATCCTAGGTTCGGTCAACGTGCGCTGTAAC
ACCATCGTGCGGCGGCGGGCTAAGGGCTCCGTGAGCCTGGAGCAGATCCTGCCCGCCGAGGAGGAGGTAC
GCGCCCGCTTGCGCTCCGGCCTCTACTCGGCGGTCATCGTCTACGACGAGCGCAGCCCGCGCGCCGAGAG
CCTCCGCGAGGACAGCACCGTGTCGCTGGTGGTGCAGGCGCTGCGCCGCAACGCCGAGCGCACCGACATC
TGCCTGCTCAAAGGCGGCTATGAGAGGTTTTCCTCCGAGTACCCAGAATTCTGTTCTAAAACCAAGGCCC
TGGCAGCCATCCCACCCCCGGTTCCCCCCAGCGCCACAGAGCCCTTGGACCTGGGCTGCAGCTCCTGTGG
GACCCCACTACACGACCAGGGGGGTCCTGTGGAGATCCTTCCCTTCCTCTACCTCGGCAGTGCCTACCAT
GCTGCCCGGAGAGACATGCTGGACGCCCTGGGCATCACGGCTCTGTTGAATGTCTCCTCGGACTGCCCAA
ACCACTTTGAAGGACACTATCAGTACAAGTGCATCCCAGTGGAAGATAACCACAAGGCCGACATCAGCTC
CTGGTTCATGGAAGCCATAGAGTACATCGATGCCGTGAAGGACTGCCGTGGGCGCGTGCTGGTGCACTGC
CAGGCGGGCATCTCGCGGTCGGCCACCATCTGCCTGGCCTACCTGATGATGAAGAAACGGGTGAGGCTGG
AGGAGGCCTTCGAGTTCGTTAAGCAGCGCCGCAGCATCATCTCGCCCAACTTCAGCTTCATGGGGCAGCT
GCTGCAGTTCGAGTCCCAGGTGCTGGCCACGTCCTGTGCTGCGGAGGCTGCTAGCCCCTCGGGACCCCTG
CGGGAGCGGGGCAAGACCCCCGCCACCCCCACCTCGCAGTTCGTCTTCAGCTTTCCGGTCTCCGTGGGCG
TGCACTCGGCCCCCAGCAGCCTGCCCTACCTGCACAGCCCCATCACCACCTCTCCCAGCTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200640 protein sequence
Red=Cloning site Green=Tags(s)

MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGYILGSVNVRCN
TIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDI
CLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYH
AARRDMLDALGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHC
QAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPL
RERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001394
ORF Size 1182 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001394.1, NM_001394.2, NM_001394.3, NM_001394.4, NM_001394.5, NM_001394.6, NP_001385.1
RefSeq Size 5625
RefSeq ORF 1185
Locus ID 1846
Cytogenetics 8p12
Domains DSPc, RHOD, PTPc_motif
Protein Families Phosphatase
Protein Pathways MAPK signaling pathway
MW 43 kDa
Gene Summary The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus. Two alternatively spliced transcript variants, encoding distinct isoforms, have been observed for this gene. In addition, multiple polyadenylation sites have been reported. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "DUSP4"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


DUSP4 mouse monoclonal antibody,clone OTI7C11
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools