BCAT2 (NM_001190) Human Tagged ORF Clone

CAT#: RC200625

Reviews ()
Write a review

BCAT2 (Myc-DDK-tagged)-Human branched chain amino-acid transaminase 2, mitochondrial (BCAT2), nuclear gene encoding mitochondrial protein, transcript variant a


Product Datasheet for 'RC200625'


  "NM_001190" in other vectors (6)

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BCAT2 (NM_001190) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BCAT2
Synonyms BCAM; BCATM; BCT2; PP18
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200625 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCAGCCGCTCTGGGGCAGATCTGGGCACGAAAGCTTCTCTCTGTCCCTTGGCTTCTGTGTGGTC
CCAGAAGATATGCCTCCTCCAGTTTCAAGGCTGCAGACCTGCAGCTGGAAATGACACAGAAGCCTCATAA
GAAGCCTGGCCCCGGCGAGCCCCTGGTGTTTGGGAAGACATTTACCGACCACATGCTGATGGTGGAATGG
AATGACAAGGGCTGGGGCCAGCCCCGAATCCAGCCCTTCCAGAACCTCACGCTGCACCCAGCCTCCTCCA
GCCTCCACTACTCCCTGCAGCTGTTTGAGGGCATGAAGGCGTTCAAAGGCAAAGACCAGCAGGTGCGCCT
CTTCCGCCCCTGGCTCAACATGGACCGGATGCTGCGCTCAGCCATGCGCCTGTGCCTGCCGAGTTTCGAC
AAGCTGGAGTTGCTGGAGTGCATCCGCCGGCTCATCGAAGTGGACAAGGACTGGGTCCCCGATGCCGCCG
GCACCAGCCTCTATGTGCGGCCTGTGCTCATTGGGAACGAGCCCTCGCTGGGTGTCAGCCAGCCCACGCG
CGCGCTCCTGTTCGTCATTCTCTGCCCAGTGGGTGCCTACTTCCCTGGAGGCTCCGTGACCCCGGTCTCC
CTCCTGGCCGACCCAGCCTTCATCCGGGCCTGGGTGGGCGGGGTCGGCAACTACAAGTTAGGTGGGAATT
ATGGGCCCACCGTGTTAGTGCAACAGGAGGCACTCAAGCGGGGCTGTGAACAGGTCCTCTGGCTGTATGG
GCCCGACCACCAGCTCACCGAGGTGGGAACCATGAACATCTTTGTCTACTGGACCCACGAAGATGGGGTG
CTGGAGCTGGTGACGCCCCCGCTGAATGGTGTTATCCTGCCTGGAGTGGTCAGACAGAGTCTACTGGACA
TGGCTCAGACCTGGGGTGAGTTCCGGGTGGTGGAGCGCACGATCACCATGAAGCAGTTGCTGCGGGCCCT
GGAGGAGGGCCGCGTGCGGGAAGTCTTTGGCTCGGGCACCGCTTGCCAGGTCTGCCCAGTGCACCGAATC
CTGTACAAAGACAGGAACCTCCACATTCCCACCATGGAAAATGGGCCTGAGCTGATCCTCCGCTTCCAGA
AGGAGCTGAAGGAGATCCAGTACGGAATCAGAGCCCACGAGTGGATGTTCCCGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200625 protein sequence
Red=Cloning site Green=Tags(s)

MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEW
NDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFD
KLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFPGGSVTPVS
LLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGV
LELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRI
LYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001190
ORF Size 1176 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001190.1, NM_001190.2, NM_001190.3, NP_001181.2
RefSeq Size 1616
RefSeq ORF 1179
Locus ID 587
Cytogenetics 19q13.33
Domains aminotran_4
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pantothenate and CoA biosynthesis, Valine, leucine and isoleucine biosynthesis, Valine, leucine and isoleucine degradation
MW 44.3 kDa
Gene Summary This gene encodes a branched chain aminotransferase found in mitochondria. The encoded protein forms a dimer that catalyzes the first step in the production of the branched chain amino acids leucine, isoleucine, and valine. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Other Versions

Other products for "BCAT2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-BCAT2 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools