EIF3B (NM_001037283) Human Tagged ORF Clone

CAT#: RC200612

Reviews ()
Write a review

EIF3B (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 2



  "NM_001037283" in other vectors (4)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol EIF3B
Synonyms EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200612 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGACGCGGAGAACGTGGCGGTGCCCGAGGCGGCCGAGGAGCGCGCCGAGCCCGGCCAGCAGCAGC
CGGCCGCCGAGCCGCCGCCAGCCGAGGGGCTGCTGCGGCCCGCGGGGCCCGGCGCTCCGGAGGCCGCGGG
GACCGAGGCCTCCAGTGAGGAGGTGGGGATCGCGGAGGCCGGGCCGGAGCCCGAGGTGAGGACCGAGCCG
GCGGCCGAGGCAGAGGCGGCCTCCGGCCCGTCCGAGTCGCCCTCGCCGCCGGCCGCCGAGGAGCTGCCCG
GGTCGCATGCTGAGCCCCCTGTCCCGGCACAGGGCGAGGCCCCAGGAGAGCAGGCTCGGGACGAGCGCTC
CGACAGCCGGGCCCAGGCGGTGTCCGAGGACGCGGGAGGAAACGAGGGCAGAGCGGCCGAGGCCGAACCC
CGGGCGCTGGAGAATGGCGACGCGGACGAGCCCTCCTTCAGCGACCCCGAGGACTTCGTGGACGACGTGA
GCGAGGAAGAATTACTGGGAGATGTACTCAAAGATCGGCCCCAGGAAGCAGATGGAATCGATTCGGTGAT
TGTAGTGGACAATGTCCCTCAGGTGGGACCCGACCGACTTGAGAAACTCAAAAATGTCATCCACAAGATC
TTTTCCAAGTTTGGGAAAATCACAAATGATTTTTATCCTGAAGAGGATGGGAAGACAAAAGGGTATATTT
TCCTGGAGTACGCGTCCCCTGCCCACGCTGTGGATGCTGTGAAGAACGCCGACGGCTACAAGCTTGACAA
GCAGCACACATTCCGGGTCAACCTCTTTACGGATTTTGACAAGTATATGACGATCAGTGACGAGTGGGAT
ATTCCAGAGAAACAGCCTTTCAAAGACCTGGGGAACTTACGTTACTGGCTTGAAGAGGCAGAATGCAGAG
ATCAGTACAGTGTGATTTTTGAGAGTGGAGACCGCACTTCCATATTCTGGAATGACGTAAAAGACCCTGT
CTCAATTGAAGAAAGAGCGAGATGGACAGAGACGTATGTGCGTTGGTCTCCTAAGGGCACCTACCTGGCT
ACCTTTCATCAAAGAGGCATTGCTCTATGGGGGGGAGAGAAATTCAAGCAAATTCAGAGATTCAGCCACC
AAGGGGTTCAGCTTATTGACTTCTCACCTTGTGAAAGGTACCTGGTGACCTTTAGCCCCCTGATGGACAC
GCAGGATGACCCTCAGGCCATAATCATCTGGGACATCCTTACGGGGCACAAGAAGAGGGGTTTTCACTGT
GAGAGCTCAGCCCATTGGCCTATTTTTAAGTGGAGCCATGATGGCAAATTCTTTGCCAGAATGACCCTGG
ATACGCTTAGCATCTATGAAACTCCTTCTATGGGTCTTTTGGACAAGAAGAGTTTGAAGATCTCTGGGAT
AAAAGACTTTTCTTGGTCTCCTGGTGGTAACATAATCGCCTTCTGGGTGCCTGAAGACAAAGATATTCCA
GCCAGGGTAACCCTGATGCAGCTCCCTACCAGGCAAGAGATCCGAGTGAGGAACCTGTTCAATGTGGTGG
ACTGCAAGCTCCATTGGCAGAAGAACGGAGACTACTTGTGTGTGAAAGTAGATAGGACTCCGAAAGGCAC
CCAGGGTGTTGTCACAAATTTTGAAATTTTCCGAATGAGGGAGAAACAGGTACCTGTGGATGTGGTCGAG
ATGAAAGAAACCATCATAGCCTTTGCCTGGGAACCAAATGGAAGTAAGTTTGCTGTGCTGCACGGAGAGG
CTCCGCGGATATCTGTGTCTTTCTACCACGTCAAAAACAACGGGAAGATTGAACTCATCAAGATGTTCGA
CAAGCAGCAGGCGAACACCATCTTCTGGAGCCCCCAAGGACAGTTCGTGGTGTTGGCGGGCCTGAGGAGT
ATGAACGGTGCCTTAGCGTTTGTGGACACTTCGGACTGCACGGTCATGAACATCGCAGAGCACTACATGG
CTTCCGACGTCGAATGGGATCCTACTGGGCGCTACGTCGTCACCTCTGTGTCCTGGTGGAGCCATAAGGT
GGACAACGCGTACTGGCTGTGGACTTTCCAGGGACGCCTCCTGCAGAAGAACAACAAGGACCGCTTCTGC
CAGCTGCTGTGGCGGCCCCGGCCTCCCACACTCCTGAGCCAGGAACAGATCAAGCAAATTAAAAAGGATC
TGAAGAAATACTCTAAGATCTTTGAACAGAAGGATCGTTTGAGTCAGTCCAAAGCCTCAAAGGAATTGGT
GGAGAGAAGGCGCACCATGATGGAAGATTTCCGGAAGTACCGGAAAATGGCCCAGGAGCTCTATATGGAG
CAGAAAAACGAGCGCCTGGAGTTGCGAGGAGGGGTGGACACTGACGAGCTGGACAGCAACGTGGACGACT
GGGAAGAGGAGACCATTGAGTTCTTCGTCACTGAAGAAATCATTCCCCTCGGGAATCAGGAG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC200612 protein sequence
Red=Cloning site Green=Tags(s)

MQDAENVAVPEAAEERAEPGQQQPAAEPPPAEGLLRPAGPGAPEAAGTEASSEEVGIAEAGPEPEVRTEP
AAEAEAASGPSESPSPPAAEELPGSHAEPPVPAQGEAPGEQARDERSDSRAQAVSEDAGGNEGRAAEAEP
RALENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKI
FSKFGKITNDFYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDEWD
IPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTETYVRWSPKGTYLA
TFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHC
ESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIP
ARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVE
MKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRS
MNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFC
QLLWRPRPPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYME
QKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001037283
ORF Size 2442 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001037283.1, NP_001032360.1
RefSeq Size 3084 bp
RefSeq ORF 2445 bp
Locus ID 8662
UniProt ID P55884
Cytogenetics 7p22.3
MW 92.5 kDa
Gene Summary RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:9388245, PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:9388245, PubMed:17581632). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "EIF3B"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.