HGS (NM_004712) Human Tagged ORF Clone

CAT#: RC200609

HGS (Myc-DDK-tagged)-Human hepatocyte growth factor-regulated tyrosine kinase substrate (HGS)

Clone Modification / Custom Cloning Service

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HGS (NM_004712) Human Tagged ORF Clone
Symbol HGS
Synonyms HRS
Vector pCMV6-Entry
Sequence Data
>RC200609 representing NM_004712
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCGAGGCAGCGGCACCTTCGAGCGTCTCCTAGACAAGGCGACCAGCCAGCTCCTGTTGGAGACAG
ATTGGGAGTCCATTTTGCAGATCTGCGACCTGATCCGCCAAGGGGACACACAAGCAAAATATGCTGTGAA
TTCCATCAAGAAGAAAGTCAACGACAAGAACCCACACGTCGCCTTGTATGCCCTGGAGGTCATGGAATCT
GTGGTAAAGAACTGTGGCCAGACAGTTCATGATGAGGTGGCCAACAAGCAGACCATGGAGGAGCTGAAGG
ACCTGCTGAAGAGACAAGTGGAGGTAAACGTCCGTAACAAGATCCTGTACCTGATCCAGGCCTGGGCGCA
TGCCTTCCGGAACGAGCCCAAGTACAAGGTGGTCCAGGACACCTACCAGATCATGAAGGTGGAGGGGCAC
GTCTTTCCAGAATTCAAAGAGAGCGATGCCATGTTTGCTGCCGAGAGAGCCCCAGACTGGGTGGACGCTG
AGGAATGCCACCGCTGCAGGGTGCAGTTCGGGGTGATGACCCGTAAGCACCACTGCCGGGCGTGTGGGCA
GATATTCTGTGGAAAGTGTTCTTCCAAGTACTCCACCATCCCCAAGTTTGGCATCGAGAAGGAGGTGCGC
GTGTGTGAGCCCTGCTACGAGCAGCTGAACAGGAAAGCGGAGGGAAAGGCCACTTCCACCACTGAGCTGC
CCCCCGAGTACCTGACCAGCCCCCTGTCTCAGCAGTCCCAGCTGCCCCCCAAGAGGGACGAGACGGCCCT
GCAGGAGGAGGAGGAGCTGCAGCTGGCCCTGGCGCTGTCACAGTCAGAGGCGGAGGAGAAGGAGAGGCTG
AGACAGAAGTCCACGTACACTTCGTACCCCAAGGCGGAGCCCATGCCCTCGGCCTCCTCAGCGCCCCCCG
CCAGCAGCCTGTACTCTTCACCTGTGAACTCGTCGGCGCCTCTGGCTGAGGACATCGACCCTGAGCTCGC
ACGGTATCTCAACCGGAACTACTGGGAGAAGAAGCAGGAGGAGGCTCGCAAGAGCCCCACGCCATCTGCG
CCCGTGCCCCTGACGGAGCCGGCTGCACAGCCTGGGGAAGGGCACGCAGCCCCCACCAACGTGGTGGAGA
ACCCCCTCCCGGAGACAGACTCTCAGCCCATTCCTCCCTCTGGTGGCCCCTTTAGTGAGCCACAGTTCCA
CAATGGCGAGTCTGAGGAGAGCCACGAGCAGTTCCTGAAGGCGCTGCAGAACGCCGTCACCACCTTCGTG
AACCGCATGAAGAGTAACCACATGCGGGGCCGCAGCATCACCAATGACTCGGCCGTGCTCTCACTCTTCC
AGTCCATCAACGGCATGCACCCGCAGCTGCTGGAGCTGCTCAACCAGCTGGACGAGCGCAGGCTGTACTA
TGAGGGGCTGCAGGACAAGCTGGCACAGATCCGCGATGCCCGGGGGGCGCTGAGTGCCCTGCGCGAAGAG
CACCGGGAGAAGCTTCGCCGGGCAGCCGAGGAGGCAGAGCGCCAGCGCCAGATCCAGCTGGCCCAGAAGC
TGGAGATAATGCGGCAGAAGAAGCAGGAGTACCTGGAGGTGCAGAGGCAGCTGGCCATCCAGCGCCTGCA
GGAGCAGGAGAAGGAGCGGCAGATGCGGCTGGAGCAGCAGAAGCAGACGGTCCAGATGCGCGCGCAGATG
CCCGCCTTCCCCCTGCCCTACGCCCAGCTCCAGGCCATGCCCGCAGCCGGAGGTGTGCTCTACCAGCCCT
CGGGACCAGCCAGCTTCCCCAGCACCTTCAGCCCTGCCGGCTCGGTGGAGGGCTCCCCAATGCACGGCGT
GTACATGAGCCAGCCGGCCCCTGCCGCTGGCCCCTACCCCAGCATGCCCAGCACTGCGGCTGATCCCAGC
ATGGTGAGTGCCTACATGTACCCAGCAGGGGCCACTGGGGCGCAGGCGGCCCCCCAGGCCCAGGCCGGAC
CCACCGCCAGCCCCGCTTACTCATCCTACCAGCCTACTCCCACAGCGGGCTACCAGAACGTGGCCTCCCA
GGCCCCACAGAGCCTCCCGGCCATCTCTCAGCCTCCGCAGTCCAGCACCATGGGCTACATGGGGAGCCAG
TCAGTCTCCATGGGCTACCAGCCTTACAACATGCAGAATCTCATGACCACCCTCCCAAGCCAGGATGCGT
CTCTGCCACCCCAGCAGCCCTACATCGCGGGGCAGCAGCCCATGTACCAGCAGATGGCACCCTCTGGCGG
TCCCCCCCAGCAGCAGCCCCCCGTGGCCCAGCAACCGCAGGCACAGGGGCCGCCGGCACAGGGCAGCGAG
GCCCAGCTCATTTCATTCGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200609 representing NM_004712
Red=Cloning site Green=Tags(s)

MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMES
VVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGH
VFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVR
VCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERL
RQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSA
PVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFV
NRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREE
HREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQM
PAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPS
MVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQ
SVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSE
AQLISFD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004712
ORF Size 2331 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004712.1, NM_004712.2, NM_004712.3, NM_004712.4, NP_004703
RefSeq Size 2926
RefSeq ORF 2334
Locus ID 9146
Cytogenetics 17q25.3
Domains FYVE, VHS, UIM
Protein Families Druggable Genome
Protein Pathways Endocytosis
MW 86 kDa
Gene Summary Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via early endosomes and may regulate trafficking to early and late endosomes by recruiting clathrin. May concentrate ubiquitinated receptors within clathrin-coated regions. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with STAM (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes. May contribute to the efficient recruitment of SMADs to the activin receptor complex. Involved in receptor recycling via its association with the CART complex, a multiprotein complex required for efficient transferrin receptor recycling but not for EGFR degradation. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)