HGS (NM_004712) Human Tagged ORF Clone

CAT#: RC200609

Reviews ()
Write a review

HGS (Myc-DDK-tagged)-Human hepatocyte growth factor-regulated tyrosine kinase substrate (HGS)



Reconstitution Protocol

USD 711.00

USD 1,067.00

In Stock*

Size
    • 10 ug

Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HGS
Synonyms HRS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200609 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCGAGGCAGCGGCACCTTCGAGCGTCTCCTAGACAAGGCGACCAGCCAGCTCCTGTTGGAGACAG
ATTGGGAGTCCATTTTGCAGATCTGCGACCTGATCCGCCAAGGGGACACACAAGCAAAATATGCTGTGAA
TTCCATCAAGAAGAAAGTCAACGACAAGAACCCACACGTCGCCTTGTATGCCCTGGAGGTCATGGAATCT
GTGGTAAAGAACTGTGGCCAGACAGTTCATGATGAGGTGGCCAACAAGCAGACCATGGAGGAGCTGAAGG
ACCTGCTGAAGAGACAAGTGGAGGTAAACGTCCGTAACAAGATCCTGTACCTGATCCAGGCCTGGGCGCA
TGCCTTCCGGAACGAGCCCAAGTACAAGGTGGTCCAGGACACCTACCAGATCATGAAGGTGGAGGGGCAC
GTCTTTCCAGAATTCAAAGAGAGCGATGCCATGTTTGCTGCCGAGAGAGCCCCAGACTGGGTGGACGCTG
AGGAATGCCACCGCTGCAGGGTGCAGTTCGGGGTGATGACCCGTAAGCACCACTGCCGGGCGTGTGGGCA
GATATTCTGTGGAAAGTGTTCTTCCAAGTACTCCACCATCCCCAAGTTTGGCATCGAGAAGGAGGTGCGC
GTGTGTGAGCCCTGCTACGAGCAGCTGAACAGGAAAGCGGAGGGAAAGGCCACTTCCACCACTGAGCTGC
CCCCCGAGTACCTGACCAGCCCCCTGTCTCAGCAGTCCCAGCTGCCCCCCAAGAGGGACGAGACGGCCCT
GCAGGAGGAGGAGGAGCTGCAGCTGGCCCTGGCGCTGTCACAGTCAGAGGCGGAGGAGAAGGAGAGGCTG
AGACAGAAGTCCACGTACACTTCGTACCCCAAGGCGGAGCCCATGCCCTCGGCCTCCTCAGCGCCCCCCG
CCAGCAGCCTGTACTCTTCACCTGTGAACTCGTCGGCGCCTCTGGCTGAGGACATCGACCCTGAGCTCGC
ACGGTATCTCAACCGGAACTACTGGGAGAAGAAGCAGGAGGAGGCTCGCAAGAGCCCCACGCCATCTGCG
CCCGTGCCCCTGACGGAGCCGGCTGCACAGCCTGGGGAAGGGCACGCAGCCCCCACCAACGTGGTGGAGA
ACCCCCTCCCGGAGACAGACTCTCAGCCCATTCCTCCCTCTGGTGGCCCCTTTAGTGAGCCACAGTTCCA
CAATGGCGAGTCTGAGGAGAGCCACGAGCAGTTCCTGAAGGCGCTGCAGAACGCCGTCACCACCTTCGTG
AACCGCATGAAGAGTAACCACATGCGGGGCCGCAGCATCACCAATGACTCGGCCGTGCTCTCACTCTTCC
AGTCCATCAACGGCATGCACCCGCAGCTGCTGGAGCTGCTCAACCAGCTGGACGAGCGCAGGCTGTACTA
TGAGGGGCTGCAGGACAAGCTGGCACAGATCCGCGATGCCCGGGGGGCGCTGAGTGCCCTGCGCGAAGAG
CACCGGGAGAAGCTTCGCCGGGCAGCCGAGGAGGCAGAGCGCCAGCGCCAGATCCAGCTGGCCCAGAAGC
TGGAGATAATGCGGCAGAAGAAGCAGGAGTACCTGGAGGTGCAGAGGCAGCTGGCCATCCAGCGCCTGCA
GGAGCAGGAGAAGGAGCGGCAGATGCGGCTGGAGCAGCAGAAGCAGACGGTCCAGATGCGCGCGCAGATG
CCCGCCTTCCCCCTGCCCTACGCCCAGCTCCAGGCCATGCCCGCAGCCGGAGGTGTGCTCTACCAGCCCT
CGGGACCAGCCAGCTTCCCCAGCACCTTCAGCCCTGCCGGCTCGGTGGAGGGCTCCCCAATGCACGGCGT
GTACATGAGCCAGCCGGCCCCTGCCGCTGGCCCCTACCCCAGCATGCCCAGCACTGCGGCTGATCCCAGC
ATGGTGAGTGCCTACATGTACCCAGCAGGGGCCACTGGGGCGCAGGCGGCCCCCCAGGCCCAGGCCGGAC
CCACCGCCAGCCCCGCTTACTCATCCTACCAGCCTACTCCCACAGCGGGCTACCAGAACGTGGCCTCCCA
GGCCCCACAGAGCCTCCCGGCCATCTCTCAGCCTCCGCAGTCCAGCACCATGGGCTACATGGGGAGCCAG
TCAGTCTCCATGGGCTACCAGCCTTACAACATGCAGAATCTCATGACCACCCTCCCAAGCCAGGATGCGT
CTCTGCCACCCCAGCAGCCCTACATCGCGGGGCAGCAGCCCATGTACCAGCAGATGGCACCCTCTGGCGG
TCCCCCCCAGCAGCAGCCCCCCGTGGCCCAGCAACCGCAGGCACAGGGGCCGCCGGCACAGGGCAGCGAG
GCCCAGCTCATTTCATTCGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200609 protein sequence
Red=Cloning site Green=Tags(s)

MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMES
VVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGH
VFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVR
VCEPCYEQLNRKAEGKATSTTELPPEYLTSPLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERL
RQKSTYTSYPKAEPMPSASSAPPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSA
PVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFV
NRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREE
HREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQM
PAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPS
MVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQ
SVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSE
AQLISFD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004712
ORF Size 2331 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004712.5
RefSeq Size 2986 bp
RefSeq ORF 2334 bp
Locus ID 9146
UniProt ID O14964
Cytogenetics 17q25.3
Domains FYVE, VHS, UIM
Protein Families Druggable Genome
Protein Pathways Endocytosis
MW 86.2 kDa
Gene Summary The protein encoded by this gene regulates endosomal sorting and plays a critical role in the recycling and degradation of membrane receptors. The encoded protein sorts monoubiquitinated membrane proteins into the multivesicular body, targeting these proteins for lysosome-dependent degradation. [provided by RefSeq, Dec 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.