SAPK4 (MAPK13) (NM_002754) Human Tagged ORF Clone

CAT#: RC200606

Reviews ()
Write a review

MAPK13 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 13 (MAPK13)



  "NM_002754" in other vectors (6)

Reconstitution Protocol

USD 457.00

USD 686.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "MAPK13"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MAPK13
Synonyms MAPK-13; MAPK 13; p38delta; PRKM13; SAPK4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200606 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCTCATCCGGAAAAAGGGCTTCTACAAGCAGGACGTCAACAAGACCGCCTGGGAGCTGCCCAAGA
CCTACGTGTCCCCGACGCACGTCGGCAGCGGGGCCTATGGCTCCGTGTGCTCGGCCATCGACAAGCGGTC
AGGGGAGAAGGTGGCCATCAAGAAGCTGAGCCGACCCTTTCAGTCCGAGATCTTCGCCAAGCGCGCCTAC
CGGGAGCTGCTGCTGCTGAAGCACATGCAGCATGAGAACGTCATTGGGCTCCTGGATGTCTTCACCCCAG
CCTCCTCCCTGCGCAACTTCTATGACTTCTACCTGGTGATGCCCTTCATGCAGACGGATCTGCAGAAGAT
CATGGGGATGGAGTTCAGTGAGGAGAAGATCCAGTACCTGGTGTATCAGATGCTCAAAGGCCTTAAGTAC
ATCCACTCTGCTGGGGTCGTGCACAGGGACCTGAAGCCAGGCAACCTGGCTGTGAATGAGGACTGTGAAC
TGAAGATTCTGGATTTTGGGCTGGCGCGACATGCAGACGCCGAGATGACTGGCTACGTGGTGACCCGCTG
GTACCGAGCCCCCGAGGTGATCCTCAGCTGGATGCACTACAACCAGACAGTGGACATCTGGTCTGTGGGC
TGTATCATGGCAGAGATGCTGACAGGGAAAACTCTGTTCAAGGGGAAAGATTACCTGGACCAGCTGACCC
AGATCCTGAAAGTGACCGGGGTGCCTGGCACGGAGTTTGTGCAGAAGCTGAACGACAAAGCGGCCAAATC
CTACATCCAGTCCCTGCCACAGACCCCCAGGAAGGATTTCACTCAGCTGTTCCCACGGGCCAGCCCCCAG
GCTGCGGACCTGCTGGAGAAGATGCTGGAGCTAGACGTGGACAAGCGCCTGACGGCCGCGCAGGCCCTCA
CCCATCCCTTCTTTGAACCCTTCCGGGACCCTGAGGAAGAGACGGAGGCCCAGCAGCCGTTTGATGATTC
CTTAGAACACGAGAAACTCACAGTGGATGAATGGAAGCAGCACATCTACAAGGAGATTGTGAACTTCAGC
CCCATTGCCCGGAAGGACTCACGGCGCCGGAGTGGCATGAAGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200606 protein sequence
Red=Cloning site Green=Tags(s)

MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAY
RELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKY
IHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVG
CIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQ
AADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFS
PIARKDSRRRSGMKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002754
ORF Size 1095 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002754.3, NP_002745.1
RefSeq Size 6348 bp
RefSeq ORF 1098 bp
Locus ID 5603
UniProt ID O15264
Cytogenetics 6p21.31
Domains pkinase, TyrKc, S_TKc
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Amyotrophic lateral sclerosis (ALS), Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, VEGF signaling pathway
MW 42.1 kDa
Gene Summary This gene encodes a member of the mitogen-activated protein (MAP) kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The encoded protein is a p38 MAP kinase and is activated by proinflammatory cytokines and cellular stress. Substrates of the encoded protein include the transcription factor ATF2 and the microtubule dynamics regulator stathmin. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.