RAMP1 (NM_005855) Human Tagged ORF Clone

CAT#: RC200587

Reviews ()
Write a review

RAMP1 (Myc-DDK-tagged)-Human receptor (G protein-coupled) activity modifying protein 1 (RAMP1)



Reconstitution Protocol

USD 150.00

USD 225.00

In Stock*

Size
    • 10 ug

Product images

Other products for "RAMP1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RAMP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200587 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGGGCCCTGTGCCGCCTCCCGCGGCGCGGCCTCTGGCTGCTCCTGGCCCATCACCTCTTCATGA
CCACTGCCTGCCAGGAGGCTAACTACGGTGCCCTCCTCCGGGAGCTCTGCCTCACCCAGTTCCAGGTAGA
CATGGAGGCCGTCGGGGAGACGCTGTGGTGTGACTGGGGCAGGACCATCAGGAGCTACAGGGAGCTGGCC
GACTGCACCTGGCACATGGCGGAGAAGCTGGGCTGCTTCTGGCCCAATGCAGAGGTGGACAGGTTCTTCC
TGGCAGTGCATGGCCGCTACTTCAGGAGCTGCCCCATCTCAGGCAGGGCCGTGCGGGACCCGCCCGGCAG
CATCCTCTACCCCTTCATCGTGGTCCCCATCACGGTGACCCTGCTGGTGACGGCACTGGTGGTCTGGCAG
AGCAAGCGCACTGAGGGCATTGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200587 protein sequence
Red=Cloning site Green=Tags(s)

MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELA
DCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQ
SKRTEGIV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005855
ORF Size 444 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005855.4
RefSeq Size 922 bp
RefSeq ORF 447 bp
Locus ID 10267
UniProt ID O60894
Cytogenetics 2q37.3
Domains RAMP
Protein Families Druggable Genome, Transmembrane
Protein Pathways Vascular smooth muscle contraction
MW 17 kDa
Gene Summary The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP1) protein, CRLR functions as a CGRP receptor. The RAMP1 protein is involved in the terminal glycosylation, maturation, and presentation of the CGRP receptor to the cell surface. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.