RAMP1 (NM_005855) Human Tagged ORF Clone
CAT#: RC200587
RAMP1 (Myc-DDK-tagged)-Human receptor (G protein-coupled) activity modifying protein 1 (RAMP1)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_005855" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | RAMP1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200587 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCCGGGCCCTGTGCCGCCTCCCGCGGCGCGGCCTCTGGCTGCTCCTGGCCCATCACCTCTTCATGA CCACTGCCTGCCAGGAGGCTAACTACGGTGCCCTCCTCCGGGAGCTCTGCCTCACCCAGTTCCAGGTAGA CATGGAGGCCGTCGGGGAGACGCTGTGGTGTGACTGGGGCAGGACCATCAGGAGCTACAGGGAGCTGGCC GACTGCACCTGGCACATGGCGGAGAAGCTGGGCTGCTTCTGGCCCAATGCAGAGGTGGACAGGTTCTTCC TGGCAGTGCATGGCCGCTACTTCAGGAGCTGCCCCATCTCAGGCAGGGCCGTGCGGGACCCGCCCGGCAG CATCCTCTACCCCTTCATCGTGGTCCCCATCACGGTGACCCTGCTGGTGACGGCACTGGTGGTCTGGCAG AGCAAGCGCACTGAGGGCATTGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200587 protein sequence
Red=Cloning site Green=Tags(s) MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELA DCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQ SKRTEGIV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005855 |
ORF Size | 444 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005855.4 |
RefSeq Size | 922 bp |
RefSeq ORF | 447 bp |
Locus ID | 10267 |
UniProt ID | O60894 |
Cytogenetics | 2q37.3 |
Domains | RAMP |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Vascular smooth muscle contraction |
MW | 17 kDa |
Gene Summary | The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP1) protein, CRLR functions as a CGRP receptor. The RAMP1 protein is involved in the terminal glycosylation, maturation, and presentation of the CGRP receptor to the cell surface. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200587L1 | Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 1 (RAMP1), Myc-DDK-tagged |
USD 450.00 |
|
RC200587L2 | Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 1 (RAMP1), mGFP tagged |
USD 450.00 |
|
RC200587L3 | Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 1 (RAMP1), Myc-DDK-tagged |
USD 450.00 |
|
RC200587L4 | Lenti ORF clone of Human receptor (G protein-coupled) activity modifying protein 1 (RAMP1), mGFP tagged |
USD 450.00 |
|
RG200587 | RAMP1 (tGFP-tagged) - Human receptor (G protein-coupled) activity modifying protein 1 (RAMP1) |
USD 350.00 |
|
SC111143 | RAMP1 (untagged)-Human receptor (G protein-coupled) activity modifying protein 1 (RAMP1) |
USD 150.00 |
{0} Product Review(s)
This clone helps up to fully evaluate the function of CGRP receptor. The clone was correct and we fully sequenced to verify. We now are assessing CGRP and its receptor role in acting on ion channels.
The clone is not toxic and well transfected and expressed in HEK cells after 24hs.
E. Javier L. on 09/13/2023