PFDN1 (NM_002622) Human Tagged ORF Clone

CAT#: RC200584

PFDN1 (Myc-DDK-tagged)-Human prefoldin subunit 1 (PFDN1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_002622" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off this product. Use code: "Clone20".

USD 150.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


PFDN1 rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "PFDN1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PFDN1
Synonyms PDF; PFD1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200584 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCCCCCGTGGATCTAGAGCTGAAGAAGGCCTTCACAGAGCTTCAAGCCAAAGTTATTGACACTC
AACAGAAGGTGAAGCTCGCAGACATACAGATTGAACAGCTAAACAGAACGAAAAAGCATGCACATCTTAC
AGATACAGAGATCATGACTTTGGTAGATGAGACTAACATGTATGAAGGTGTAGGAAGAATGTTTATTCTT
CAGTCCAAGGAAGCAATTCACAGTCAGCTGTTAGAGAAGCAGAAAATAGCAGAAGAAAAAATTAAAGAAC
TAGAACAGAAAAAGTCCTACCTGGAGCGAAGCGTTAAGGAAGCTGAGGACAACATCCGGGAGATGCTGAT
GGCACGAAGGGCCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200584 protein sequence
Red=Cloning site Green=Tags(s)

MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFIL
QSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002622
ORF Size 366 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002622.5
RefSeq Size 1324 bp
RefSeq ORF 369 bp
Locus ID 5201
UniProt ID O60925
Cytogenetics 5q31.3
Protein Families Transcription Factors
MW 14.2 kDa
Gene Summary This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.