CRTAP (NM_006371) Human Tagged ORF Clone

CAT#: RC200555

CRTAP (Myc-DDK-tagged)-Human cartilage associated protein (CRTAP)

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CRTAP (NM_006371) Human Tagged ORF Clone
Symbol CRTAP
Synonyms CASP; LEPREL3; OI7; P3H5
Vector pCMV6-Entry
Sequence Data
>RC200555 representing NM_006371
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCGGGGCGCCGGGGGGCCGCGGCGCTGCTAGCGCTGCTGTGCGTGGCCTGCGCGCTGCGCGCCG
GGCGCGCCCAATACGAACGCTACAGCTTCCGCAGCTTCCCACGGGACGAGCTGATGCCGCTCGAGTCGGC
CTACCGGCACGCGCTGGACAAGTACAGCGGCGAGCACTGGGCCGAGAGCGTGGGCTACCTGGAGATCAGC
CTGCGGCTGCACCGCTTGCTGCGCGACAGCGAGGCCTTCTGCCACCGCAACTGCAGCGCCGCGCCGCAGC
CCGAGCCCGCCGCCGGCCTCGCCAGCTATCCCGAGCTGCGCCTCTTCGGGGGCCTGCTGCGCCGCGCGCA
CTGCCTCAAGCGCTGCAAGCAGGGCCTGCCAGCCTTCCGCCAGTCCCAGCCCAGCCGCGATGTGCTGGCG
GACTTCCAGCGCCGCGAGCCCTACAAGTTCCTGCAGTTCGCTTACTTCAAGGCAAATAATCTCCCCAAAG
CCATCGCCGCTGCTCACACCTTTCTACTGAAGCATCCTGATGACGAAATGATGAAGAGGAACATGGCATA
TTATAAGAGCCTGCCTGGTGCCGAGGACTACATTAAAGACCTGGAAACCAAGTCATATGAAAGCCTGTTC
ATCCGAGCAGTGCGGGCATACAACGGTGAGAACTGGAGAACATCCATCACAGACATGGAGCTGGCCCTTC
CCGACTTCTTCAAAGCCTTTTACGAGTGTCTCGCAGCCTGCGAGGGTTCCAGGGAGATCAAGGACTTCAA
GGATTTCTACCTTTCCATAGCAGATCATTATGTAGAAGTTCTGGAATGCAAAATACAGTGTGAAGAGAAC
CTCACCCCAGTTATAGGAGGCTATCCGGTTGAGAAATTTGTGGCTACCATGTATCATTACTTGCAGTTTG
CCTATTATAAGTTGAACGACCTGAAGAATGCAGCCCCCTGTGCAGTCAGCTATCTGCTCTTTGATCAGAA
TGACAAGGTCATGCAGCAGAACCTGGTGTATTACCAGTACCACAGGGACACGTGGGGCCTCTCAGATGAG
CACTTCCAGCCCAGACCTGAAGCAGTTCAGTTCTTTAATGTGACCACACTCCAGAAGGAGCTGTATGACT
TTGCTAAGGAAAATATAATGGATGATGATGAGGGAGAAGTTGTGGAATATGTGGATGACCTCTTGGAACT
GGAGGAGACCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200555 representing NM_006371
Red=Cloning site Green=Tags(s)

MEPGRRGAAALLALLCVACALRAGRAQYERYSFRSFPRDELMPLESAYRHALDKYSGEHWAESVGYLEIS
LRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLKRCKQGLPAFRQSQPSRDVLA
DFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYESLF
IRAVRAYNGENWRTSITDMELALPDFFKAFYECLAACEGSREIKDFKDFYLSIADHYVEVLECKIQCEEN
LTPVIGGYPVEKFVATMYHYLQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDE
HFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006371
ORF Size 1203 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006371.1, NM_006371.2, NM_006371.3, NM_006371.4, NP_006362
RefSeq Size 6622
RefSeq ORF 1206
Locus ID 10491
Cytogenetics 3p22.3
Protein Families Secreted Protein, Transmembrane
MW 46.55 kDa
Gene Summary The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli. Defects in this gene are associated with osteogenesis imperfecta, a connective tissue disorder characterized by bone fragility and low bone mass. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)