Claudin 7 (CLDN7) (NM_001307) Human Tagged ORF Clone

CAT#: RC200530

CLDN7 (Myc-DDK-tagged)-Human claudin 7 (CLDN7), transcript variant 1

Product Images

Circular map for RC200530

• 

  Western blot validation of overexpression lysate (Cat# LY420015) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200530 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Claudin 7
• Synonyms: CEPTRL2; claudin-1; CLDN-7; CPETRL2; Hs.84359
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200530 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCAATTCGGGCCTGCAGTTGCTGGGCTTCTCCATGGCCCTGCTGGGCTGGGTGGGTCTGGTGGCCT
  GCACCGCCATCCCGCAGTGGCAGATGAGCTCCTATGCGGGTGACAACATCATCACGGCCCAGGCCATGTA
  CAAGGGGCTGTGGATGGACTGCGTCACGCAGAGCACGGGGATGATGAGCTGCAAAATGTACGACTCGGTG
  CTCGCCCTGTCCGCGGCCTTGCAGGCCACTCGAGCCCTAATGGTGGTCTCCCTGGTGCTGGGCTTCCTGG
  CCATGTTTGTGGCCACGATGGGCATGAAGTGCACGCGCTGTGGGGGAGACGACAAAGTGAAGAAGGCCCG
  TATAGCCATGGGTGGAGGCATAATTTTCATCGTGGCAGGTCTTGCCACCTTGGTAGCTTGCTCCTGGTAT
  GGCCATCAGATTGTCACAGACTTTTATAACCCTTTGATCCCTACCAACATTAAGTATGAGTTTGGCCCTG
  CCATCTTTATTGGCTGGGCAGGGTCTGCCCTAGTCATCCTGGGAGGTGCACTGCTCTCCTGTTCCTGTCC
  TGGGAATGAGAGCAAGGCTGGGTACCGTGCACCCCGCTCTTACCCTAAGTCCAACTCTTCCAAGGAGTAT
  GTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200530 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSV
  LALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWY
  GHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEY
  V
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001307
• ORF Size: 633 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
• Note: Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required.

Reference Data

• RefSeq: NM_001307.3, NP_001298.2
• RefSeq Size: 2029 bp
• RefSeq ORF: 636 bp
• Locus ID: 1366
• UniProt ID: O95471
• Cytogenetics: 17p13.1
• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction
• MW: 22.4 kDa
• Gene Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, May 2010]