P70 S6 Kinase beta (RPS6KB2) (NM_003952) Human Tagged ORF Clone

CAT#: RC200525

Reviews ()
Write a review

RPS6KB2 (Myc-DDK-tagged)-Human ribosomal protein S6 kinase, 70kDa, polypeptide 2 (RPS6KB2)


  "NM_003952" in other vectors (7)

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name P70 S6 Kinase beta (RPS6KB2) (NM_003952) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RPS6KB2
Synonyms KLS; p70(S6K)-beta; P70-beta; P70-beta-1; P70-beta-2; p70S6Kb; S6K-beta2; S6K2; S6KB; S6Kbeta; S6KI(2); SRK; STK14B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200525 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCGTGTTTGATTTGGATTTGGAGACGGAGGAAGGCAGCGAGGGCGAGGGCGAGCCAGAGCTCA
GCCCCGCGGACGCATGTCCCCTTGCCGAGTTGAGGGCAGCTGGCCTAGAGCCTGTGGGACACTATGAAGA
GGTGGAGCTGACTGAGACCAGCGTGAACGTTGGCCCAGAGCGCATCGGGCCCCACTGCTTTGAGCTGCTG
CGTGTGCTGGGCAAGGGGGGCTATGGCAAGGTGTTCCAGGTGCGAAAGGTGCAAGGCACCAACTTGGGCA
AAATATATGCCATGAAAGTCCTAAGGAAGGCCAAAATTGTGCGCAATGCCAAGGACACAGCACACACACG
GGCTGAGCGGAACATTCTAGAGTCAGTGAAGCACCCCTTTATTGTGGAACTGGCCTATGCCTTCCAGACT
GGTGGCAAACTCTACCTCATCCTTGAGTGCCTCAGTGGTGGCGAGCTCTTCACGCATCTGGAGCGAGAGG
GCATCTTCCTGGAAGATACGGCCTGCTTCTACCTGGCTGAGATCACGCTGGCCCTGGGCCATCTCCACTC
CCAGGGCATCATCTACCGGGACCTCAAGCCCGAGAACATCATGCTCAGCAGCCAGGGCCACATCAAACTG
ACCGACTTTGGACTCTGCAAGGAGTCTATCCATGAGGGCGCCGTCACTCACACCTTCTGCGGCACCATTG
AGTACATGGCCCCTGAGATTCTGGTGCGCAGTGGCCACAACCGGGCTGTGGACTGGTGGAGCCTGGGGGC
CCTGATGTACGACATGCTCACTGGATCGCCGCCCTTTACCGCAGAGAACCGGAAGAAAACCATGGATAAG
ATCATCAGGGGCAAGCTGGCACTGCCCCCCTACCTCACCCCAGATGCCCGGGACCTTGTCAAAAAGTTTC
TGAAACGGAATCCCAGCCAGCGGATTGGGGGTGGCCCAGGGGATGCTGCTGATGTGCAGAGACATCCCTT
TTTCCGGCACATGAATTGGGACGACCTTCTGGCCTGGCGTGTGGACCCCCCTTTCAGGCCCTGTCTGCAG
TCAGAGGAGGACGTGAGCCAGTTTGATACCCGCTTCACACGGCAGACGCCGGTGGACAGTCCTGATGACA
CAGCCCTCAGCGAGAGTGCCAACCAGGCCTTCCTGGGCTTCACATACGTGGCGCCGTCTGTCCTGGACAG
CATCAAGGAGGGCTTCTCCTTCCAGCCCAAGCTGCGCTCACCCAGGCGCCTCAACAGTAGCCCCCGGGTC
CCCGTCAGCCCCCTCAAGTTCTCCCCTTTTGAGGGGTTTCGGCCCAGCCCCAGCCTGCCGGAGCCCACGG
AGCTACCTCTACCTCCACTCCTGCCACCGCCGCCGCCCTCGACCACCGCCCCTCTCCCCATCCGTCCCCC
CTCAGGGACCAAGAAGTCCAAGAGGGGCCGTGGGCGTCCAGGGCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200525 protein sequence
Red=Cloning site Green=Tags(s)

MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELL
RVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQT
GGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKL
TDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDK
IIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQ
SEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRV
PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRPGR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003952
ORF Size 1446 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003952.2, NP_003943.2
RefSeq Size 1782
RefSeq ORF 1449
Locus ID 6199
Cytogenetics 11q13.2
Domains pkinase, S_TK_X, TyrKc, S_TKc
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Acute myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Insulin signaling pathway, mTOR signaling pathway, TGF-beta signaling pathway
MW 53.5 kDa
Gene Summary This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains a kinase catalytic domain and phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation. [provided by RefSeq, Jan 2015]

Other Versions

Other products for "RPS6KB2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-RPS6KB2 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools