Retinoid X Receptor beta (RXRB) (NM_021976) Human Tagged ORF Clone

CAT#: RC200516

Reviews ()
Write a review

RXRB (Myc-DDK-tagged)-Human retinoid X receptor, beta (RXRB)



  "NM_021976" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RXRB
Synonyms DAUDI6; H-2RIIBP; NR2B2; RCoR-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200516 representing NM_021976
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTGGGCCGCTCGCCCGCCCTTCCTCCCTCAGCGGCATGCCGCAGGGCAGTGTGGGCCGGTGGGGG
TGCGAAAAGAAATGCATTGTGGGGTCGCGTCCCGGTGGCGGCGGCGACGGCCCTGGCTGGATCCCGCAGC
GGCGGCGGCGGCGGCGGTGGCAGGCGGAGAACAACAAACCCCGGAGCCGGAGCCAGGGGAGGCTGGACGG
GACGGGATGGGCGACAGCGGGCGGGACTCCCGAAGCCCAGACAGCTCCTCCCCAAATCCCCTTCCCCAGG
GAGTCCCTCCCCCTTCTCCTCCTGGGCCACCCCTACCCCCTTCAACAGCTCCATCCCTTGGAGGCTCTGG
GGCCCCACCCCCACCCCCGATGCCACCACCCCCACTGGGCTCTCCCTTTCCAGTCATCAGTTCTTCCATG
GGGTCCCCTGGTCTGCCCCCTCCAGCTCCCCCAGGATTCTCCGGGCCTGTCAGCAGCCCCCAGATTAACT
CAACAGTGTCACTCCCTGGGGGTGGGTCTGGCCCCCCTGAAGATGTGAAGCCACCAGTCTTAGGGGTCCG
GGGCCTGCACTGTCCACCCCCTCCAGGTGGCCCTGGGGCTGGCAAACGGCTATGTGCAATCTGCGGGGAC
AGAAGCTCAGGCAAACACTACGGGGTTTACAGCTGTGAGGGTTGCAAGGGCTTCTTCAAACGCACCATCC
GCAAAGACCTTACATACTCTTGCCGGGACAACAAAGACTGCACAGTGGACAAGCGCCAGCGGAACCGCTG
TCAGTACTGCCGCTATCAGAAGTGCCTGGCCACTGGCATGAAGAGGGAGGCGGTACAGGAGGAGCGTCAG
CGGGGAAAGGACAAGGATGGGGATGGGGAGGGGGCTGGGGGAGCCCCCGAGGAGATGCCTGTGGACAGGA
TCCTGGAGGCAGAGCTTGCTGTGGAACAGAAGAGTGACCAGGGCGTTGAGGGTCCTGGGGGAACCGGGGG
TAGCGGCAGCAGCCCAAATGACCCTGTGACTAACATCTGTCAGGCAGCTGACAAACAGCTATTCACGCTT
GTTGAGTGGGCGAAGAGGATCCCACACTTTTCCTCCTTGCCTCTGGATGATCAGGTCATATTGCTGCGGG
CAGGCTGGAATGAACTCCTCATTGCCTCCTTTTCACACCGATCCATTGATGTTCGAGATGGCATCCTCCT
TGCCACAGGTCTTCACGTGCACCGCAACTCAGCCCATTCAGCAGGAGTAGGAGCCATCTTTGATCGGGTG
CTGACAGAGCTAGTGTCCAAAATGCGTGACATGAGGATGGACAAGACAGAGCTTGGCTGCCTGAGGGCAA
TCATTCTGTTTAATCCAGATGCCAAGGGCCTCTCCAACCCTAGTGAGGTGGAGGTCCTGCGGGAGAAAGT
GTATGCATCACTGGAGACCTACTGCAAACAGAAGTACCCTGAGCAGCAGGGACGGTTTGCCAAGCTGCTG
CTACGTCTTCCTGCCCTCCGGTCCATTGGCCTTAAGTGTCTAGAGCATCTGTTTTTCTTCAAGCTCATTG
GTGACACCCCCATCGACACCTTCCTCATGGAGATGCTTGAGGCTCCCCATCAACTGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200516 representing NM_021976
Red=Cloning site Green=Tags(s)

MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGR
DGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSM
GSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGD
RSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQ
RGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTL
VEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021976
ORF Size 1599 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021976.2
RefSeq Size 2892 bp
RefSeq ORF 1602 bp
Locus ID 6257
UniProt ID P28702
Cytogenetics 6p21.32
Domains HOLI, zf-C4
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways Adipocytokine signaling pathway, Non-small cell lung cancer, Pathways in cancer, PPAR signaling pathway, Small cell lung cancer, Thyroid cancer
MW 56.7 kDa
Gene Summary This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). The encoded protein forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Other Versions

Other products for "RXRB"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-RXRB Antibody
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.