Retinoid X Receptor beta(RXRB) (NM_021976) Human Tagged ORF Clone

CAT#: RC200516

RXRB (Myc-DDK-tagged)-Human retinoid X receptor, beta (RXRB)

Change vector?

USD 98

USD 560


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Retinoid X Receptor beta(RXRB) (NM_021976) Human Tagged ORF Clone
Symbol RXRB
Synonyms DAUDI6; H-2RIIBP; NR2B2; RCoR-1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200516 representing NM_021976
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTGGGCCGCTCGCCCGCCCTTCCTCCCTCAGCGGCATGCCGCAGGGCAGTGTGGGCCGGTGGGGG
TGCGAAAAGAAATGCATTGTGGGGTCGCGTCCCGGTGGCGGCGGCGACGGCCCTGGCTGGATCCCGCAGC
GGCGGCGGCGGCGGCGGTGGCAGGCGGAGAACAACAAACCCCGGAGCCGGAGCCAGGGGAGGCTGGACGG
GACGGGATGGGCGACAGCGGGCGGGACTCCCGAAGCCCAGACAGCTCCTCCCCAAATCCCCTTCCCCAGG
GAGTCCCTCCCCCTTCTCCTCCTGGGCCACCCCTACCCCCTTCAACAGCTCCATCCCTTGGAGGCTCTGG
GGCCCCACCCCCACCCCCGATGCCACCACCCCCACTGGGCTCTCCCTTTCCAGTCATCAGTTCTTCCATG
GGGTCCCCTGGTCTGCCCCCTCCAGCTCCCCCAGGATTCTCCGGGCCTGTCAGCAGCCCCCAGATTAACT
CAACAGTGTCACTCCCTGGGGGTGGGTCTGGCCCCCCTGAAGATGTGAAGCCACCAGTCTTAGGGGTCCG
GGGCCTGCACTGTCCACCCCCTCCAGGTGGCCCTGGGGCTGGCAAACGGCTATGTGCAATCTGCGGGGAC
AGAAGCTCAGGCAAACACTACGGGGTTTACAGCTGTGAGGGTTGCAAGGGCTTCTTCAAACGCACCATCC
GCAAAGACCTTACATACTCTTGCCGGGACAACAAAGACTGCACAGTGGACAAGCGCCAGCGGAACCGCTG
TCAGTACTGCCGCTATCAGAAGTGCCTGGCCACTGGCATGAAGAGGGAGGCGGTACAGGAGGAGCGTCAG
CGGGGAAAGGACAAGGATGGGGATGGGGAGGGGGCTGGGGGAGCCCCCGAGGAGATGCCTGTGGACAGGA
TCCTGGAGGCAGAGCTTGCTGTGGAACAGAAGAGTGACCAGGGCGTTGAGGGTCCTGGGGGAACCGGGGG
TAGCGGCAGCAGCCCAAATGACCCTGTGACTAACATCTGTCAGGCAGCTGACAAACAGCTATTCACGCTT
GTTGAGTGGGCGAAGAGGATCCCACACTTTTCCTCCTTGCCTCTGGATGATCAGGTCATATTGCTGCGGG
CAGGCTGGAATGAACTCCTCATTGCCTCCTTTTCACACCGATCCATTGATGTTCGAGATGGCATCCTCCT
TGCCACAGGTCTTCACGTGCACCGCAACTCAGCCCATTCAGCAGGAGTAGGAGCCATCTTTGATCGGGTG
CTGACAGAGCTAGTGTCCAAAATGCGTGACATGAGGATGGACAAGACAGAGCTTGGCTGCCTGAGGGCAA
TCATTCTGTTTAATCCAGATGCCAAGGGCCTCTCCAACCCTAGTGAGGTGGAGGTCCTGCGGGAGAAAGT
GTATGCATCACTGGAGACCTACTGCAAACAGAAGTACCCTGAGCAGCAGGGACGGTTTGCCAAGCTGCTG
CTACGTCTTCCTGCCCTCCGGTCCATTGGCCTTAAGTGTCTAGAGCATCTGTTTTTCTTCAAGCTCATTG
GTGACACCCCCATCGACACCTTCCTCATGGAGATGCTTGAGGCTCCCCATCAACTGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200516 representing NM_021976
Red=Cloning site Green=Tags(s)

MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGR
DGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSM
GSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGD
RSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQ
RGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTL
VEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRV
LTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021976
ORF Size 1599 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021976.1, NM_021976.2, NM_021976.3, NM_021976.4, NP_068811
RefSeq Size 2892
RefSeq ORF 1602
Locus ID 6257
Cytogenetics 6p21.32
Domains HOLI, zf-C4
Protein Families Nuclear Hormone Receptor, Transcription Factors, Druggable Genome
Protein Pathways PPAR signaling pathway, Adipocytokine signaling pathway, Pathways in cancer, Thyroid cancer, Small cell lung cancer, Non-small cell lung cancer
MW 56.7 kDa
Gene Summary This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). The encoded protein forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations