CDC25A (NM_001789) Human Tagged ORF Clone

CAT#: RC200496

CDC25A (Myc-DDK-tagged)-Human cell division cycle 25 homolog A (S. pombe) (CDC25A), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name CDC25A (NM_001789) Human Tagged ORF Clone
Symbol CDC25A
Synonyms CDC25A2
Vector pCMV6-Entry
Sequence Data
>RC200496 representing NM_001789
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACTGGGCCCGGAGCCCCCGCACCGCCGCCGCCTGCTCTTCGCCTGCAGCCCCCCTCCCGCGTCGC
AGCCCGTCGTGAAGGCGCTATTTGGCGCTTCAGCCGCCGGGGGACTGTCGCCTGTCACCAACCTGACCGT
CACTATGGACCAGCTGCAGGGTCTGGGCAGTGATTATGAGCAACCACTGGAGGTGAAGAACAACAGTAAT
CTGCAGAGAATGGGCTCCTCCGAGTCAACAGATTCAGGTTTCTGTCTAGATTCTCCTGGGCCATTGGACA
GTAAAGAAAACCTTGAAAATCCTATGAGAAGAATACATTCCCTACCTCAGAAGCTGTTGGGATGTAGTCC
AGCTCTGAAGAGGAGCCATTCTGATTCTCTTGACCATGACATCTTTCAGCTCATCGACCCAGATGAGAAC
AAGGAAAATGAAGCCTTTGAGTTTAAGAAGCCAGTAAGACCTGTATCTCGTGGCTGCCTGCACTCTCATG
GACTCCAGGAGGGTAAAGATCTCTTCACACAGAGGCAGAACTCTGCCCCAGCTCGGATGCTTTCCTCAAA
TGAAAGAGATAGCAGTGAACCAGGGAATTTCATTCCTCTTTTTACACCCCAGTCACCTGTGACAGCCACT
TTGTCTGATGAGGATGATGGCTTCGTGGACCTTCTCGATGGAGAGAATCTGAAGAATGAGGAGGAGACCC
CCTCGTGCATGGCAAGCCTCTGGACAGCTCCTCTCGTCATGAGAACTACAAACCTTGACAACCGATGCAA
GCTGTTTGACTCCCCTTCCCTGTGTAGCTCCAGCACTCGGTCAGTGTTGAAGAGACCAGAACGATCTCAA
GAGGAGTCTCCACCTGGAAGTACAAAGAGGAGGAAGAGCATGTCTGGGGCCAGCCCCAAAGAGTCAACTA
ATCCAGAGAAGGCCCATGAGACTCTTCATCAGTCTTTATCCCTGGCATCTTCCCCCAAAGGAACCATTGA
GAACATTTTGGACAATGACCCAAGGGACCTTATAGGAGACTTCTCCAAGGGTTATCTCTTTCATACAGTT
GCTGGGAAACATCAGGATTTAAAATACATCTCTCCAGAAATTATGGCATCTGTTTTGAATGGCAAGTTTG
CCAACCTCATTAAAGAGTTTGTTATCATCGACTGTCGATACCCATATGAATACGAGGGAGGCCACATCAA
GGGTGCAGTGAACTTGCACATGGAAGAAGAGGTTGAAGACTTCTTATTGAAGAAGCCCATTGTACCTACT
GATGGCAAGCGTGTCATTGTTGTGTTTCACTGCGAGTTTTCTTCTGAGAGAGGTCCCCGCATGTGCCGGT
ATGTGAGAGAGAGAGATCGCCTGGGTAATGAATACCCCAAACTCCACTACCCTGAGCTGTATGTCCTGAA
GGGGGGATACAAGGAGTTCTTTATGAAATGCCAGTCTTACTGTGAGCCCCCTAGCTACCGGCCCATGCAC
CACGAGGACTTTAAAGAAGACCTGAAGAAGTTCCGCACCAAGAGCCGGACCTGGGCAGGGGAGAAGAGCA
AGAGGGAGATGTACAGTCGTCTGAAGAAGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200496 representing NM_001789
Red=Cloning site Green=Tags(s)

MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYEQPLEVKNNSN
LQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALKRSHSDSLDHDIFQLIDPDEN
KENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTAT
LSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQ
EESPPGSTKRRKSMSGASPKESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTV
AGKHQDLKYISPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSYCEPPSYRPMH
HEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001789
ORF Size 1572 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001789.1, NM_001789.2, NP_001780
RefSeq Size 3717
RefSeq ORF 1575
Locus ID 993
Cytogenetics 3p21.31
Domains RHOD
Protein Families Phosphatase, Druggable Genome
Protein Pathways Cell cycle, Progesterone-mediated oocyte maturation
MW 58.9 kDa
Gene Summary Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Directly dephosphorylates CDK1 and stimulates its kinase activity. Also dephosphorylates CDK2 in complex with cyclin E, in vitro. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)