CDC25A (NM_001789) Human Tagged ORF Clone

CAT#: RC200496

Reviews ()
Write a review

CDC25A (Myc-DDK-tagged)-Human cell division cycle 25 homolog A (S. pombe) (CDC25A), transcript variant 1


 Cited in 2 publications.

  "NM_001789" in other vectors (6)

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name CDC25A (NM_001789) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CDC25A
Synonyms CDC25A2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200496 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACTGGGCCCGGAGCCCCCGCACCGCCGCCGCCTGCTCTTCGCCTGCAGCCCCCCTCCCGCGTCGC
AGCCCGTCGTGAAGGCGCTATTTGGCGCTTCAGCCGCCGGGGGACTGTCGCCTGTCACCAACCTGACCGT
CACTATGGACCAGCTGCAGGGTCTGGGCAGTGATTATGAGCAACCACTGGAGGTGAAGAACAACAGTAAT
CTGCAGAGAATGGGCTCCTCCGAGTCAACAGATTCAGGTTTCTGTCTAGATTCTCCTGGGCCATTGGACA
GTAAAGAAAACCTTGAAAATCCTATGAGAAGAATACATTCCCTACCTCAGAAGCTGTTGGGATGTAGTCC
AGCTCTGAAGAGGAGCCATTCTGATTCTCTTGACCATGACATCTTTCAGCTCATCGACCCAGATGAGAAC
AAGGAAAATGAAGCCTTTGAGTTTAAGAAGCCAGTAAGACCTGTATCTCGTGGCTGCCTGCACTCTCATG
GACTCCAGGAGGGTAAAGATCTCTTCACACAGAGGCAGAACTCTGCCCCAGCTCGGATGCTTTCCTCAAA
TGAAAGAGATAGCAGTGAACCAGGGAATTTCATTCCTCTTTTTACACCCCAGTCACCTGTGACAGCCACT
TTGTCTGATGAGGATGATGGCTTCGTGGACCTTCTCGATGGAGAGAATCTGAAGAATGAGGAGGAGACCC
CCTCGTGCATGGCAAGCCTCTGGACAGCTCCTCTCGTCATGAGAACTACAAACCTTGACAACCGATGCAA
GCTGTTTGACTCCCCTTCCCTGTGTAGCTCCAGCACTCGGTCAGTGTTGAAGAGACCAGAACGATCTCAA
GAGGAGTCTCCACCTGGAAGTACAAAGAGGAGGAAGAGCATGTCTGGGGCCAGCCCCAAAGAGTCAACTA
ATCCAGAGAAGGCCCATGAGACTCTTCATCAGTCTTTATCCCTGGCATCTTCCCCCAAAGGAACCATTGA
GAACATTTTGGACAATGACCCAAGGGACCTTATAGGAGACTTCTCCAAGGGTTATCTCTTTCATACAGTT
GCTGGGAAACATCAGGATTTAAAATACATCTCTCCAGAAATTATGGCATCTGTTTTGAATGGCAAGTTTG
CCAACCTCATTAAAGAGTTTGTTATCATCGACTGTCGATACCCATATGAATACGAGGGAGGCCACATCAA
GGGTGCAGTGAACTTGCACATGGAAGAAGAGGTTGAAGACTTCTTATTGAAGAAGCCCATTGTACCTACT
GATGGCAAGCGTGTCATTGTTGTGTTTCACTGCGAGTTTTCTTCTGAGAGAGGTCCCCGCATGTGCCGGT
ATGTGAGAGAGAGAGATCGCCTGGGTAATGAATACCCCAAACTCCACTACCCTGAGCTGTATGTCCTGAA
GGGGGGATACAAGGAGTTCTTTATGAAATGCCAGTCTTACTGTGAGCCCCCTAGCTACCGGCCCATGCAC
CACGAGGACTTTAAAGAAGACCTGAAGAAGTTCCGCACCAAGAGCCGGACCTGGGCAGGGGAGAAGAGCA
AGAGGGAGATGTACAGTCGTCTGAAGAAGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200496 protein sequence
Red=Cloning site Green=Tags(s)

MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYEQPLEVKNNSN
LQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALKRSHSDSLDHDIFQLIDPDEN
KENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTAT
LSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQ
EESPPGSTKRRKSMSGASPKESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTV
AGKHQDLKYISPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSYCEPPSYRPMH
HEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001789
ORF Size 1572 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001789.1, NM_001789.2, NP_001780.2
RefSeq Size 3717
RefSeq ORF 1575
Locus ID 993
Cytogenetics 3p21.31
Domains RHOD
Protein Families Druggable Genome, Phosphatase
Protein Pathways Cell cycle, Progesterone-mediated oocyte maturation
MW 59.1 kDa
Gene Summary CDC25A is a member of the CDC25 family of phosphatases. CDC25A is required for progression from G1 to the S phase of the cell cycle. It activates the cyclin-dependent kinase CDC2 by removing two phosphate groups. CDC25A is specifically degraded in response to DNA damage, which prevents cells with chromosomal abnormalities from progressing through cell division. CDC25A is an oncogene, although its exact role in oncogenesis has not been demonstrated. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Citations (2)

Other Versions

Other products for "CDC25A"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Cdc25A Antibody
    • 100 ug

USD 409.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools