Casein Kinase 1 delta(CSNK1D) (NM_001893) Human Tagged ORF Clone

CAT#: RC200482

CSNK1D (Myc-DDK-tagged)-Human casein kinase 1, delta (CSNK1D), transcript variant 1

Change vector?

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Casein Kinase 1 delta(CSNK1D) (NM_001893) Human Tagged ORF Clone
Symbol CSNK1D
Synonyms ASPS; CKIdelta; FASPS2; HCKID
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200482 representing NM_001893
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGAGAGTCGGGAACAGGTACCGGCTGGGCCGGAAGATCGGCAGCGGCTCCTTCGGAGACATCT
ATCTCGGTACGGACATTGCTGCAGGAGAAGAGGTTGCCATCAAGCTTGAATGTGTCAAAACCAAACACCC
TCAGCTCCACATTGAGAGCAAAATCTACAAGATGATGCAGGGAGGAGTGGGCATCCCCACCATCAGATGG
TGCGGGGCAGAGGGGGACTACAACGTCATGGTGATGGAGCTGCTGGGGCCAAGCCTGGAGGACCTCTTCA
ACTTCTGCTCCAGGAAATTCAGCCTCAAAACCGTCCTGCTGCTTGCTGACCAAATGATCAGTCGCATCGA
ATACATTCATTCAAAGAACTTCATCCACCGGGATGTGAAGCCAGACAACTTCCTCATGGGCCTGGGGAAG
AAGGGCAACCTGGTGTACATCATCGACTTCGGGCTGGCCAAGAAGTACCGGGATGCACGCACCCACCAGC
ACATCCCCTATCGTGAGAACAAGAACCTCACGGGGACGGCGCGGTACGCCTCCATCAACACGCACCTTGG
AATTGAACAATCCCGAAGAGATGACTTGGAGTCTCTGGGCTACGTGCTAATGTACTTCAACCTGGGCTCT
CTCCCCTGGCAGGGGCTGAAGGCTGCCACCAAGAGACAGAAATACGAAAGGATTAGCGAGAAGAAAATGT
CCACCCCCATCGAAGTGTTGTGTAAAGGCTACCCTTCCGAATTTGCCACATACCTGAATTTCTGCCGTTC
CTTGCGTTTTGACGACAAGCCTGACTACTCGTACCTGCGGCAGCTTTTCCGGAATCTGTTCCATCGCCAG
GGCTTCTCCTATGACTACGTGTTCGACTGGAACATGCTCAAATTTGGTGCCAGCCGGGCCGCCGATGACG
CCGAGCGGGAGCGCAGGGACCGAGAGGAGCGGCTGAGACACTCGCGGAACCCGGCTACCCGCGGCCTCCC
TTCCACAGCCTCCGGCCGCCTGCGGGGGACGCAGGAAGTGGCTCCCCCCACACCCCTCACCCCTACCTCA
CACACGGCTAACACCTCCCCCCGGCCTGTCTCCGGCATGGAGAGAGAGCGGAAAGTGAGTATGCGGCTGC
ACCGCGGGGCCCCCGTCAACATCTCCTCGTCCGACCTCACAGGCCGACAAGATACCTCTCGCATGTCCAC
CTCACAGATTCCTGGTCGGGTGGCTTCCAGTGGTCTTCAGTCTGTCGTGCACCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200482 representing NM_001893
Red=Cloning site Green=Tags(s)

MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQGGVGIPTIRW
CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK
KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS
LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ
GFSYDYVFDWNMLKFGASRAADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTS
HTANTSPRPVSGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001893
ORF Size 1245 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001893.1, NM_001893.2, NM_001893.3, NM_001893.4, NP_001884
RefSeq Size 2030
Locus ID 1453
Cytogenetics 17q25.3
Domains pkinase, TyrKc, S_TKc
Protein Families Protein Kinase, Druggable Genome
Protein Pathways Hedgehog signaling pathway, Gap junction, Circadian rhythm - mammal
MW 47.1 kDa
Gene Summary This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein may also be involved in the regulation of apoptosis, circadian rhythm, microtubule dynamics, chromosome segregation, and p53-mediated effects on growth. The encoded protein is highly similar to the mouse and rat CK1 delta homologs. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.