PRMT2 (NM_206962) Human Tagged ORF Clone

CAT#: RC200461

Reviews ()
Write a review

PRMT2 (Myc-DDK-tagged)-Human protein arginine methyltransferase 2 (PRMT2), transcript variant 1



Reconstitution Protocol

USD 457.00

USD 686.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PRMT2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PRMT2
Synonyms HRMT1L1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200461 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAACATCAGGTGACTGTCCCAGAAGTGAATCGCAGGGAGAAGAGCCTGCTGAGTGCAGTGAGGCGG
GTCTCCTGCAGGAGGGAGTACAGCCAGAGGAGTTTGTGGCCATCGCGGACTACGCTGCCACCGATGAGAC
CCAGCTCAGTTTTTTGAGAGGAGAAAAAATTCTTATCCTGAGACAAACCACTGCAGATTGGTGGTGGGGT
GAGCGTGCGGGCTGCTGTGGGTACATTCCGGCAAACCATGTGGGGAAGCACGTGGATGAGTACGACCCCG
AGGACACGTGGCAGGATGAAGAGTACTTCGGCAGCTATGGAACTCTGAAACTCCACTTGGAGATGTTGGC
AGACCAGCCACGAACAACTAAATACCACAGTGTCATCCTGCAGAATAAAGAATCCCTGACGGATAAAGTC
ATCCTGGACGTGGGCTGTGGGACTGGGATCATCAGTCTCTTCTGTGCACACTATGCGCGGCCTAGAGCGG
TGTACGCGGTGGAGGCCAGTGAGATGGCACAGCACACGGGGCAGCTGGTCCTGCAGAACGGCTTTGCTGA
CATCATCACCGTGTACCAGCAGAAGGTGGAGGATGTGGTGCTGCCCGAGAAGGTGGACGTGCTGGTGTCT
GAGTGGATGGGGACCTGCCTGCTGTTTGAGTTCATGATCGAGTCCATCCTGTATGCCCGGGATGCCTGGC
TGAAGGAGGACGGGGTCATTTGGCCCACCATGGCTGCGTTGCACCTTGTGCCCTGCAGTGCTGATAAGGA
TTATCGTAGCAAGGTGCTCTTCTGGGACAACGCGTACGAGTTCAACCTCAGCGCTCTGAAATCTTTAGCA
GTTAAGGAGTTTTTTTCAAAGCCCAAGTATAACCACATTTTGAAACCAGAAGACTGTCTCTCTGAACCGT
GCACTATATTGCAGTTGGACATGAGAACCGTGCAAATTTCTGATCTAGAGACCCTGAGGGGCGAGCTGCG
CTTCGACATCAGGAAGGCGGGGACCCTGCACGGCTTCACGGCCTGGTTTAGCGTCCACTTCCAGAGCCTG
CAGGAGGGGCAGCCGCCGCAGGTGCTCAGCACCGGGCCCTTCCACCCCACCACACACTGGAAGCAGACGC
TGTTCATGATGGACGACCCAGTCCCTGTCCATACAGGAGACGTGGTCACGGGTTCAGTTGTGTTGCAGAG
AAACCCAGTGTGGATAAGGCACATGTCTGTGGCTCTGAGCTGGGCTGTCACTTCCAGACAAGACCCCACA
TCTCAAAAAGTTGGAGAAAAAGTCTTCCCCATCTGGAGA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC200461 protein sequence
Red=Cloning site Green=Tags(s)

MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWG
ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKV
ILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVS
EWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLA
VKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSL
QEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPT
SQKVGEKVFPIWR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_206962
ORF Size 1299 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_206962.4
RefSeq Size 2446 bp
RefSeq ORF 1302 bp
Locus ID 3275
UniProt ID P55345
Cytogenetics 21q22.3
Protein Families Druggable Genome
MW 49 kDa
Gene Summary Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation.[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.