ICAM2 (NM_000873) Human Tagged ORF Clone

CAT#: RC200459

ICAM2 (Myc-DDK-tagged)-Human intercellular adhesion molecule 2 (ICAM2), transcript variant 5

Product Images

Circular map for RC200459

• 

  Western blot validation of overexpression lysate (Cat# LY424476) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200459 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified ICAM2 protein (Cat# TP300459). The protein was produced from HEK293T cells transfected with ICAM2 cDNA clone (Cat# RC200459) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: ICAM2
• Synonyms: CD102
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200459 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCCTCTTTCGGTTACAGGACCCTGACTGTGGCCCTCTTCACCCTGATCTGCTGTCCAGGATCGGATG
  AGAAGGTATTCGAGGTACACGTGAGGCCAAAGAAGCTGGCGGTTGAGCCCAAAGGGTCCCTCGAGGTCAA
  CTGCAGCACCACCTGTAACCAGCCTGAAGTGGGTGGTCTGGAGACCTCTCTAGATAAGATTCTGCTGGAC
  GAACAGGCTCAGTGGAAACATTACTTGGTCTCAAACATCTCCCATGACACGGTCCTCCAATGCCACTTCA
  CCTGCTCCGGGAAGCAGGAGTCAATGAATTCCAACGTCAGCGTGTACCAGCCTCCAAGGCAGGTCATCCT
  GACACTGCAACCCACTTTGGTGGCTGTGGGCAAGTCCTTCACCATTGAGTGCAGGGTGCCCACCGTGGAG
  CCCCTGGACAGCCTCACCCTCTTCCTGTTCCGTGGCAATGAGACTCTGCACTATGAGACCTTCGGGAAGG
  CAGCCCCTGCTCCGCAGGAGGCCACAGCCACATTCAACAGCACGGCTGACAGAGAGGATGGCCACCGCAA
  CTTCTCCTGCCTGGCTGTGCTGGACTTGATGTCTCGCGGTGGCAACATCTTTCACAAACACTCAGCCCCG
  AAGATGTTGGAGATCTATGAGCCTGTGTCGGACAGCCAGATGGTCATCATAGTCACGGTGGTGTCGGTGT
  TGCTGTCCCTGTTCGTGACATCTGTCCTGCTCTGCTTCATCTTCGGCCAGCACTTGCGCCAGCAGCGGAT
  GGGCACCTACGGGGTGCGAGCGGCTTGGAGGAGGCTGCCCCAGGCCTTCCGGCCA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200459 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLD
  EQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVE
  PLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAP
  KMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_000873
• ORF Size: 825 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_000873.3
• RefSeq Size: 1229 bp
• RefSeq ORF: 828 bp
• Locus ID: 3384
• UniProt ID: P13598
• Cytogenetics: 17q23.3
• Domains: ICAM_N
• Protein Families: ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Natural killer cell mediated cytotoxicity
• MW: 30.7 kDa
• Gene Summary: The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]