IRF5 (NM_032643) Human Tagged ORF Clone

CAT#: RC200458

Reviews ()
Write a review

IRF5 (Myc-DDK-tagged)-Human interferon regulatory factor 5 (IRF5), transcript variant 2



  "NM_032643" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IRF5
Synonyms SLEB10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200458 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCAGTCCATCCCAGTGGCTCCCACCCCACCCCGCCGCGTGCGGCTGAAGCCCTGGCTGGTGGCCC
AGGTGAACAGCTGCCAGTACCCAGGGCTTCAATGGGTCAACGGGGAAAAGAAATTATTCTGCATCCCCTG
GAGGCATGCCACAAGGCATGGTCCCAGCCAGGACGGAGATAACACCATCTTCAAGGCCTGGGCCAAGGAG
ACAGGGAAATACACCGAAGGCGTGGATGAAGCCGATCCGGCCAAGTGGAAGGCCAACCTGCGCTGTGCCC
TTAACAAGAGCCGGGACTTCCGCCTCATCTACGACGGGCCCCGGGACATGCCACCTCAGCCCTACAAGAT
CTACGAGGTCTGCTCCAATGGCCCTGCTCCCACAGACTCCCAGCCCCCTGAGGATTACTCTTTTGGTGCA
GGAGAGGAGGAGGAAGAAGAGGAAGAGCTGCAGAGGATGTTGCCAAGCCTGAGCCTCACAGAGGATGTCA
AGTGGCCGCCCACTCTGCAGCCGCCCACTCTGCGGCCGCCTACTCTGCAGCCGCCCACTCTGCAGCCGCC
CGTGGTGCTGGGTCCCCCTGCTCCAGACCCCAGCCCCCTGGCTCCTCCCCCTGGCAACCCTGCTGGCTTC
AGGGAGCTTCTCTCTGAGGTCCTGGAGCCTGGGCCCCTGCCTGCCAGCCTGCCCCCTGCAGGCGAACAGC
TCCTGCCAGACCTGCTGATCAGCCCCCACATGCTGCCTCTGACCGACCTGGAGATCAAGTTTCAGTACCG
GGGGCGGCCACCCCGGGCCCTCACCATCAGCAACCCCCATGGCTGCCGGCTCTTCTACAGCCAGCTGGAG
GCCACCCAGGAGCAGGTGGAACTCTTCGGCCCCATAAGCCTGGAGCAAGTGCGCTTCCCCAGCCCTGAGG
ACATCCCCAGTGACAAGCAGCGCTTCTACACGAACCAGCTGCTGGATGTCCTGGACCGCGGGCTCATCCT
CCAGCTACAGGGCCAGGACCTTTATGCCATCCGCCTGTGTCAGTGCAAGGTGTTCTGGAGCGGGCCTTGT
GCCTCAGCCCATGACTCATGCCCCAACCCCATCCAGCGGGAGGTCAAGACCAAGCTTTTCAGCCTGGAGC
ATTTTCTCAATGAGCTCATCCTGTTCCAAAAGGGCCAGACCAACACCCCACCACCCTTCGAGATCTTCTT
CTGCTTTGGGGAAGAATGGCCTGACCGCAAACCCCGAGAGAAGAAGCTCATTACTGTACAGGTGGTGCCT
GTAGCAGCTCGACTGCTGCTGGAGATGTTCTCAGGGGAGCTATCTTGGTCAGCTGATAGTATCCGGCTAC
AGATCTCAAACCCAGACCTCAAAGACCGCATGGTGGAGCAATTCAAGGAGCTCCATCACATCTGGCAGTC
CCAGCAGCGGTTGCAGCCTGTGGCCCAGGCCCCTCCTGGAGCAGGCCTTGGTGTTGGCCAGGGGCCCTGG
CCTATGCACCCAGCTGGCATGCAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200458 protein sequence
Red=Cloning site Green=Tags(s)

MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE
TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA
GEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGF
RELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLE
ATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPC
ASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVP
VAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPW
PMHPAGMQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_032643
ORF Size 1494 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032643.4
RefSeq Size 2778 bp
RefSeq ORF 1497 bp
Locus ID 3663
UniProt ID Q13568
Cytogenetics 7q32.1
Domains IRF
Protein Families Transcription Factors
Protein Pathways Toll-like receptor signaling pathway
MW 56 kDa
Gene Summary This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. [provided by RefSeq, Dec 2016]

Other Versions

Other products for "IRF5"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


IRF5 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.