Nck beta (NCK2) (NM_001004720) Human Tagged ORF Clone

CAT#: RC200449

Reviews ()
Write a review

NCK2 (Myc-DDK-tagged)-Human NCK adaptor protein 2 (NCK2), transcript variant 2



  "NM_001004720" in other vectors (4)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Nck beta (NCK2) (NM_001004720) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NCK2
Synonyms GRB4; NCKbeta
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200449 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGAAGAAGTTATTGTGATAGCCAAGTGGGACTACACCGCCCAGCAGGACCAGGAGCTGGACATCA
AGAAGAACGAGCGGCTGTGGTTGCTGGACGACTCCAAGACGTGGTGGCGGGTGAGGAACGCGGCCAACAG
GACGGGCTATGTACCGTCCAACTACGTGGAGCGGAAGAACAGCCTGAAGAAGGGCTCCCTCGTGAAGAAC
CTGAAGGACACACTAGGCCTCGGCAAGACGCGCAGGAAGACCAGCGCGCGGGATGCGTCCCCCACGCCCA
GCACGGACGCCGAGTACCCCGCCAATGGCAGCGGCGCCGACCGCATCTACGACCTCAACATCCCGGCCTT
CGTCAAGTTCGCCTATGTGGCCGAGCGGGAGGATGAGTTGTCCCTGGTGAAGGGGTCGCGCGTCACCGTC
ATGGAGAAGTGCAGCGACGGTTGGTGGCGGGGCAGCTACAACGGGCAGATCGGCTGGTTCCCCTCCAACT
ACGTCTTGGAGGAGGTGGACGAGGCGGCTGCGGAGTCCCCAAGCTTCCTGAGCCTGCGCAAGGGCGCCTC
GCTGAGCAATGGCCAGGGCTCCCGCGTGCTGCATGTGGTCCAGACGCTGTACCCCTTCAGCTCAGTCACC
GAGGAGGAGCTCAACTTCGAGAAGGGGGAGACCATGGAGGTGATTGAGAAGCCGGAGAACGACCCCGAGT
GGTGGAAATGCAAAAATGCCCGGGGCCAGGTGGGCCTCGTCCCCAAAAACTACGTGGTGGTCCTCAGTGA
CGGGCCTGCCCTGCACCCTGCGCACGCCCCACAGATAAGCTACACCGGGCCCTCGTCCAGCGGGCGCTTC
GCGGGCAGAGAGTGGTACTACGGGAACGTGACGCGGCACCAGGCCGAGTGCGCCCTCAACGAGCGGGGCG
TGGAGGGCGACTTCCTCATTAGGGACAGCGAGTCCTCGCCCAGCGACTTCTCCGTGTCCCTTAAAGCGTC
AGGGAAGAACAAACACTTCAAGGTGCAGCTCGTGGACAATGTCTACTGCATTGGGCAGCGGCGCTTCCAC
ACCATGGACGAGCTGGTGGAACACTACAAAAAGGCGCCCATCTTCACCAGCGAGCACGGGGAGAAGCTCT
ACCTCGTCAGGGCCCTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200449 protein sequence
Red=Cloning site Green=Tags(s)

MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKN
LKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTV
MEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVT
EEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRF
AGREWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFH
TMDELVEHYKKAPIFTSEHGEKLYLVRALQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001004720
ORF Size 1140 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001004720.3
RefSeq Size 2417 bp
RefSeq ORF 1143 bp
Locus ID 8440
UniProt ID O43639, A0A0S2Z4M6
Cytogenetics 2q12.2
Protein Families Druggable Genome
Protein Pathways Axon guidance, ErbB signaling pathway, Pathogenic Escherichia coli infection, T cell receptor signaling pathway
MW 42.9 kDa
Gene Summary This gene encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of receptor protein tyrosine kinases. It is through these regulatory activities that this protein is believed to be involved in cytoskeletal reorganization. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "NCK2"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


NCK2 mouse monoclonal antibody,clone OTI4H7
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools