OGDH (NM_002541) Human Tagged ORF Clone

CAT#: RC200446

OGDH (Myc-DDK-tagged)-Human oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) (OGDH), nuclear gene encoding mitochondrial protein, transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_002541" in other vectors (7)

Reconstitution Protocol

USD 891.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


OGDH Rabbit polyclonal Antibody
    • 100 ul

USD 365.00

Other products for "OGDH"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol OGDH
Synonyms AKGDH; E1k; KGD1; OGDC; OGDH2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200446 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTCATTTAAGGACTTGTGCTGCTAAGTTGAGACCATTGACGGCTTCCCAGACTGTTAAGACATTTT
CACAAAACAGACCAGCAGCAGCTAGGACATTTCAACAGATTCGGTGCTATTCTGCACCTGTTGCTGCTGA
GCCCTTTCTCAGTGGGACTAGTTCGAACTATGTGGAGGAGATGTACTGTGCTTGGCTGGAAAACCCCAAA
AGTGTACATAAGTCATGGGACATTTTTTTTCGCAACACGAATGCCGGAGCCCCACCGGGCACTGCCTACC
AGAGTCCCCTTCCCCTGAGCCGAGGCTCCCTGGCTGCTGTGGCCCATGCACAGTCCCTGGTAGAAGCACA
GCCCAACGTGGACAAGCTCGTGGAGGACCACCTGGCAGTGCAGTCGCTCATCAGGGCATATCAGATACGA
GGGCACCATGTAGCACAGCTGGACCCCCTGGGGATTTTGGATGCTGATCTGGACTCCTCCGTGCCCGCTG
ACATTATCTCATCCACAGACAAACTTGGGTTCTATGGCCTGGATGAGTCTGACCTCGACAAGGTCTTCCA
CTTGCCCACCACCACTTTCATCGGGGGACAGGAATCAGCACTTCCTCTGCGGGAGATCATCCGTCGGCTG
GAGATGGCCTACTGCCAGCATATTGGGGTGGAGTTCATGTTCATCAATGACCTGGAGCAGTGCCAGTGGA
TCCGGCAGAAGTTTGAGACCCCTGGGATCATGCAGTTCACAAATGAGGAGAAACGGACCCTGCTGGCCAG
GCTTGTGCGGTCCACCAGGTTTGAGGAGTTCCTACAGCGGAAGTGGTCCTCTGAGAAGCGCTTTGGTCTA
GAAGGCTGCGAGGTACTGATCCCTGCCCTCAAGACCATCATTGACAAGTCTAGTGAGAATGGCGTGGACT
ACGTGATCATGGGCATGCCACACAGAGGGCGGCTGAACGTGCTTGCAAATGTCATCAGGAAGGAGCTGGA
ACAGATCTTCTGTCAATTCGATTCAAAGCTGGAGGCAGCTGATGAGGGCTCCGGAGATGTGAAGTACCAC
CTGGGCATGTATCACCGCAGGATCAATCGTGTCACCGACAGGAACATTACCTTGTCCTTGGTGGCCAACC
CTTCCCACCTTGAGGCCGCTGACCCCGTGGTGATGGGCAAGACCAAAGCCGAACAGTTTTACTGTGGCGA
CACTGAAGGGAAAAAGGTCATGTCCATCCTGTTGCATGGGGATGCTGCATTTGCTGGCCAGGGCATTGTG
TACGAGACCTTCCACCTCAGCGACCTGCCATCCTACACAACTCATGGCACCGTGCACGTGGTCGTCAACA
ACCAGATCGGCTTCACCACCGACCCTCGGATGGCCCGCTCCTCCCCCTACCCCACTGACGTGGCCCGAGT
GGTGAATGCCCCCATTTTCCACGTGAACTCAGATGACCCCGAGGCTGTCATGTACGTGTGCAAAGTGGCG
GCCGAGTGGAGGAGCACCTTCCACAAGGACGTGGTTGTCGATTTGGTGTGTTACCGGCGCAACGGCCACA
ACGAGATGGATGAGCCCATGTTCACGCAGCCGCTCATGTACAAGCAGATCCGCAAGCAGAAGCCTGTGTT
ACAGAAGTACGCTGAGCTGCTGGTGTCGCAGGGTGTGGTCAACCAGCCTGAGTATGAGGAGGAAATTTCC
AAGTATGATAAGATCTGTGAGGAAGCTTTTGCCAGATCTAAAGATGAGAAGATCTTGCACATTAAGCACT
GGCTGGACTCTCCCTGGCCTGGCTTCTTCACCCTGGACGGGCAGCCCAGGAGCATGTCCTGCCCCTCCAC
GGGTCTGACGGAGGATATTCTGACACACATCGGGAATGTGGCTAGTTCTGTGCCTGTGGAAAACTTTACT
ATTCATGGAGGGCTGAGCCGGATCTTGAAGACTCGTGGGGAAATGGTGAAGAACCGGACTGTGGACTGGG
CTCTAGCGGAGTACATGGCGTTTGGCTCGCTCCTGAAGGAGGGCATCCACATTCGGCTGAGCGGCCAGGA
CGTGGAGCGGGGCACATTCAGCCACCGCCACCATGTGCTCCATGACCAGAATGTGGACAAGAGAACCTGC
ATCCCCATGAACCATCTCTGGCCCAATCAGGCCCCCTATACTGTGTGCAACAGCTCACTGTCTGAGTACG
GCGTGCTGGGCTTTGAGCTGGGCTTCGCCATGGCCAGTCCTAATGCCCTGGTCCTCTGGGAAGCCCAATT
TGGTGACTTCCACAACACGGCCCAGTGTATCATCGACCAGTTCATCTGCCCGGGACAAGCCAAGTGGGTG
CGGCAGAATGGCATCGTGTTGCTGCTGCCCCATGGCATGGAGGGCATGGGTCCAGAACATTCCTCCGCCC
GCCCAGAGCGGTTCTTGCAGATGTGCAACGATGACCCAGATGTCCTGCCAGACCTTAAAGAAGCCAACTT
CGACATCAATCAGCTATATGACTGCAATTGGGTTGTTGTCAACTGCTCCACTCCTGGCAACTTCTTCCAC
GTGCTACGACGCCAGATCCTGCTGCCATTCCGGAAGCCGTTAATTATCTTCACCCCCAAATCCCTGTTGC
GCCACCCCGAGGCCAGATCCAGCTTTGATGAGATGCTTCCAGGAACCCACTTCCAGCGGGTGATCCCAGA
AGATGGCCCTGCAGCTCAGAACCCAGAAAATGTCAAAAGGCTTCTCTTCTGCACCGGCAAAGTGTATTAT
GACCTCACCCGGGAGCGCAAAGCACGCGACATGGTGGGGCAGGTGGCCATCACAAGGATTGAGCAGCTGT
CGCCATTCCCCTTTGACCTCCTGCTGAAGGAGGTGCAGAAGTACCCCAATGCTGAGCTGGCCTGGTGCCA
GGAGGAGCACAAGAACCAAGGCTACTATGACTACGTGAAGCCAAGACTTCGGACCACCATCAGCCGCGCC
AAGCCCGTCTGGTATGCCGGCCGGGACCCAGCGGCTGCTCCAGCCACCGGCAACAAGAAGACCCACCTGA
CGGAGCTGCAGCGCCTCCTGGACACGGCCTTCGACCTGGACGTCTTCAAGAACTTCTCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200446 protein sequence
Red=Cloning site Green=Tags(s)

MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCAWLENPK
SVHKSWDIFFRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIR
GHHVAQLDPLGILDADLDSSVPADIISSTDKLGFYGLDESDLDKVFHLPTTTFIGGQESALPLREIIRRL
EMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGL
EGCEVLIPALKTIIDKSSENGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYH
LGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIV
YETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVA
AEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEIS
KYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRSMSCPSTGLTEDILTHIGNVASSVPVENFT
IHGGLSRILKTRGEMVKNRTVDWALAEYMAFGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTC
IPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWV
RQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFH
VLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYY
DLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTISRA
KPVWYAGRDPAAAPATGNKKTHLTELQRLLDTAFDLDVFKNFS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002541
ORF Size 3069 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002541.4
RefSeq Size 4319 bp
RefSeq ORF 3072 bp
Locus ID 4967
UniProt ID Q02218
Cytogenetics 7p13
Domains E1_dehydrog, transket_pyr
Protein Families Druggable Genome
Protein Pathways Citrate cycle (TCA cycle), Lysine degradation, Metabolic pathways, Tryptophan metabolism
MW 115.9 kDa
Gene Summary This gene encodes one subunit of the 2-oxoglutarate dehydrogenase complex. This complex catalyzes the overall conversion of 2-oxoglutarate (alpha-ketoglutarate) to succinyl-CoA and CO(2) during the Krebs cycle. The protein is located in the mitochondrial matrix and uses thiamine pyrophosphate as a cofactor. A congenital deficiency in 2-oxoglutarate dehydrogenase activity is believed to lead to hypotonia, metabolic acidosis, and hyperlactatemia. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Sep 2009]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.