PDZK1 (NM_002614) Human Tagged ORF Clone

CAT#: RC200444

Reviews ()
Write a review

PDZK1 (Myc-DDK-tagged)-Human PDZ domain containing 1 (PDZK1), transcript variant 1



  "NM_002614" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 483.00

USD 725.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "PDZK1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PDZK1
Synonyms CAP70; CLAMP; NHERF-3; NHERF3; PDZD1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200444 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCTCCACCTTCAACCCCCGAGAATGTAAACTGTCCAAGCAAGAAGGGCAAAACTATGGCTTCTTCC
TGCGAATTGAGAAGGACACCGAGGGCCACCTGGTCCGGGTGGTTGAGAAGTGTAGCCCAGCAGAGAAGGC
TGGCCTTCAAGATGGAGACAGAGTTCTTAGGATCAATGGTGTCTTTGTGGACAAAGAAGAACATATGCAG
GTTGTGGATCTGGTCAGAAAGAGTGGGAATTCAGTGACTTTACTAGTTCTGGATGGGGATTCCTATGAGA
AAGCAGTGAAAACACGGGTGGACTTGAAAGAGTTGGGTCAAAGTCAGAAGGAGCAAGGTTTGAGTGATAA
TATACTTTCCCCTGTGATGAATGGAGGTGTGCAAACTTGGACCCAGCCCCGGCTCTGCTATCTCGTGAAG
GAAGGAGGCAGCTATGGCTTCTCTCTGAAAACTGTCCAAGGTAAAAAGGGGGTGTACATGACTGATATTA
CACCTCAAGGTGTGGCTATGAGAGCTGGAGTTCTGGCTGATGATCACTTGATTGAAGTGAATGGAGAGAA
TGTAGAGGATGCCAGCCATGAGGAAGTGGTTGAAAAGGTGAAGAAGTCAGGAAGCCGTGTCATGTTCCTG
CTGGTGGACAAAGAAACTGACAAGCGTCATGTTGAGCAGAAGATACAATTCAAAAGAGAAACAGCCAGTT
TGAAACTGTTACCCCACCAGCCCCGAATTGTGGAGATGAAGAAAGGAAGCAATGGCTATGGTTTCTATCT
GAGGGCAGGCTCAGAACAGAAAGGTCAAATCATCAAGGACATAGATTCTGGAAGTCCAGCAGAGGAGGCT
GGCTTGAAGAACAATGATCTGGTAGTTGCTGTCAACGGCGAGTCTGTGGAAACCCTGGATCATGACAGTG
TGGTAGAAATGATTAGAAAGGGTGGAGATCAGACTTCACTGTTGGTGGTAGACAAAGAGACGGACAACAT
GTACAGACTGGCTCATTTTTCTCCATTTCTCTACTATCAAAGTCAAGAACTGCCCAATGGCTCTGTCAAG
GAGGCTCCAGCTCCTACTCCCACTTCTCTGGAAGTCTCAAGTCCACCAGATACTACAGAGGAAGTAGATC
ATAAGCCTAAACTCTGCAGGCTGGCTAAAGGTGAAAATGGCTATGGCTTTCACTTAAATGCGATTCGGGG
TCTGCCAGGCTCATTCATCAAAGAGGTACAGAAGGGCGGTCCTGCTGACTTGGCTGGGCTAGAGGATGAG
GATGTCATCATTGAAGTGAATGGGGTGAATGTGCTAGATGAACCCTATGAGAAGGTGGTGGATAGAATCC
AGAGCAGTGGGAAGAATGTCACACTTCTAGTCTGTGGAAAGAAGGCCTATGATTATTTCCAAGCTAAGAA
AATCCCTATTGTTTCCTCCCTGGCTGATCCACTTGACACCCCTCCAGATTCTAAAGAAGGAATAGTGGTG
GAGTCAAACCATGACTCGCACATGGCAAAAGAACGGGCCCACAGTACAGCCTCACATTCTTCTTCCAATT
CTGAAGATACAGAGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200444 protein sequence
Red=Cloning site Green=Tags(s)

MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQDGDRVLRINGVFVDKEEHMQ
VVDLVRKSGNSVTLLVLDGDSYEKAVKTRVDLKELGQSQKEQGLSDNILSPVMNGGVQTWTQPRLCYLVK
EGGSYGFSLKTVQGKKGVYMTDITPQGVAMRAGVLADDHLIEVNGENVEDASHEEVVEKVKKSGSRVMFL
LVDKETDKRHVEQKIQFKRETASLKLLPHQPRIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEA
GLKNNDLVVAVNGESVETLDHDSVVEMIRKGGDQTSLLVVDKETDNMYRLAHFSPFLYYQSQELPNGSVK
EAPAPTPTSLEVSSPPDTTEEVDHKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDE
DVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAYDYFQAKKIPIVSSLADPLDTPPDSKEGIVV
ESNHDSHMAKERAHSTASHSSSNSEDTEM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002614
ORF Size 1557 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002614.4
RefSeq Size 2301 bp
RefSeq ORF 1560 bp
Locus ID 5174
UniProt ID Q5T2W1
Cytogenetics 1q21.1
Domains PDZ
MW 57.1 kDa
Gene Summary This gene encodes a PDZ domain-containing scaffolding protein. PDZ domain-containing molecules bind to and mediate the subcellular localization of target proteins. The encoded protein mediates the localization of cell surface proteins and plays a critical role in cholesterol metabolism by regulating the HDL receptor, scavenger receptor class B type 1. Single nucleotide polymorphisms in this gene may be associated with metabolic syndrome, and overexpression of this gene may play a role in drug resistance of multiple myeloma. Pseudogenes of this gene are located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.