PLCG 2(PLCG2) (NM_002661) Human Tagged ORF Clone

CAT#: RC200442

PLCG2 (Myc-DDK-tagged)-Human phospholipase C, gamma 2 (phosphatidylinositol-specific) (PLCG2)

Change vector?

USD 98.00

USD 800.00


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name PLCG 2(PLCG2) (NM_002661) Human Tagged ORF Clone
Symbol PLCG2
Synonyms APLAID; FCAS3; PLC-gamma-2; PLC-IV
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200442 representing NM_002661
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACCACGGTCAATGTAGATTCCCTTGCGGAATATGAGAAGAGCCAGATCAAGAGAGCCCTGGAGC
TGGGGACGGTGATGACTGTGTTCAGCTTCCGCAAGTCCACCCCCGAGCGGAGAACCGTCCAGGTGATCAT
GGAGACGCGGCAGGTGGCCTGGAGCAAGACCGCCGACAAGATCGAGGGCTTCTTGGATATCATGGAAATA
AAAGAAATCCGCCCAGGGAAGAACTCCAAAGATTTCGAGCGAGCAAAAGCAGTTCGCCAGAAAGAAGACT
GCTGCTTCACCATCCTATATGGCACTCAGTTCGTCCTCAGCACGCTCAGCTTGGCAGCTGACTCTAAAGA
GGATGCAGTTAACTGGCTCTCTGGCTTGAAAATCTTACACCAGGAAGCGATGAATGCGTCCACGCCCACC
ATTATCGAGAGTTGGCTGAGAAAGCAGATATATTCTGTGGATCAAACCAGAAGAAACAGCATCAGTCTCC
GAGAGTTGAAGACCATCTTGCCCCTGATCAACTTTAAAGTGAGCAGTGCCAAGTTCCTTAAAGATAAGTT
TGTGGAAATAGGAGCACACAAAGATGAGCTCAGCTTTGAACAGTTCCATCTCTTCTATAAAAAACTTATG
TTTGAACAGCAAAAATCGATTCTCGATGAATTCAAAAAGGATTCGTCCGTGTTCATCCTGGGGAACACTG
ACAGGCCGGATGCCTCTGCTGTTTACCTGCGTGACTTCCAGAGGTTTCTCATACATGAACAGCAGGAGCA
TTGGGCTCAGGATCTGAACAAAGTCCGTGAGCGGATGACAAAGTTCATTGATGACACCATGCGTGAAACT
GCTGAGCCTTTCTTGTTTGTGGATGAGTTCCTCACGTACCTGTTTTCACGAGAAAACAGCATCTGGGATG
AGAAGTATGACGCGGTGGACATGCAGGACATGAACAACCCCCTGTCTCATTACTGGATCTCCTCGTCACA
TAACACGTACCTTACAGGTGACCAGCTGCGGAGCGAGTCGTCCCCAGAAGCTTACATCCGCTGCCTGCGC
ATGGGCTGTCGCTGCATTGAACTGGACTGCTGGGACGGGCCCGATGGGAAGCCGGTCATCTACCATGGCT
GGACGCGGACTACCAAGATCAAGTTTGACGACGTCGTGCAGGCCATCAAAGACCACGCCTTTGTTACGTC
GAGCTTCCCAGTGATCCTGTCCATCGAGGAGCACTGCAGCGTGGAGCAACAGCGTCACATGGCCAAGGCC
TTCAAGGAAGTATTTGGCGACCTGCTGTTGACGAAGCCCACGGAGGCCAGTGCTGACCAGCTGCCCTCGC
CCAGCCAGCTGCGGGAGAAGATCATCATCAAGCATAAGAAGCTGGGCCCCCGAGGCGATGTGGATGTCAA
CATGGAGGACAAGAAGGACGAACACAAGCAACAGGGGGAGCTGTACATGTGGGATTCCATTGACCAGAAA
TGGACTCGGCACTACTGCGCCATTGCCGATGCCAAGCTGTCCTTCAGTGATGACATTGAACAGACTATGG
AGGAGGAAGTGCCCCAGGATATACCCCCTACAGAACTACATTTTGGGGAGAAATGGTTCCACAAGAAGGT
GGAGAAGAGGACGAGTGCCGAGAAGTTGCTGCAGGAATACTGCATGGAGACGGGGGGCAAGGATGGCACC
TTCCTGGTTCGGGAGAGCGAGACCTTCCCCAATGACTACACCCTGTCCTTCTGGCGGTCAGGCCGGGTCC
AGCACTGCCGGATCCGCTCCACCATGGAGGGCGGGACCCTGAAATACTACTTGACTGACAACCTCACCTT
CAGCAGCATCTATGCCCTCATCCAGCACTACCGCGAGACGCACCTGCGCTGCGCCGAGTTCGAGCTGCGG
CTCACGGACCCTGTGCCCAACCCCAACCCCCACGAGTCCAAGCCGTGGTACTATGACAGCCTGAGCCGCG
GAGAGGCAGAGGACATGCTGATGAGGATTCCCCGGGACGGGGCCTTCCTGATCCGGAAGCGAGAGGGGAG
CGACTCCTATGCCATCACCTTCAGGGCTAGGGGCAAGGTAAAGCATTGTCGCATCAACCGGGACGGCCGG
CACTTTGTGCTGGGGACCTCCGCCTATTTTGAGAGTCTGGTGGAGCTCGTCAGTTACTACGAGAAGCATT
CACTCTACCGAAAGATGAGACTGCGCTACCCCGTGACCCCCGAGCTCCTGGAGCGCTACAATATGGAAAG
AGATATAAACTCCCTCTACGACGTCAGCAGAATGTATGTGGATCCCAGTGAAATCAATCCGTCCATGCCT
CAGAGAACCGTGAAAGCTCTGTATGACTACAAAGCCAAGCGAAGCGATGAGCTGAGCTTCTGCCGTGGTG
CCCTCATCCACAATGTCTCCAAGGAGCCCGGGGGCTGGTGGAAAGGAGACTATGGAACCAGGATCCAGCA
GTACTTCCCATCCAACTACGTCGAGGACATCTCAACTGCAGACTTCGAGGAGCTAGAAAAGCAGATTATT
GAAGACAATCCCTTAGGGTCTCTTTGCAGAGGAATATTGGACCTCAATACCTATAACGTCGTGAAAGCCC
CTCAGGGAAAAAACCAGAAGTCCTTTGTCTTCATCCTGGAGCCCAAGCAGCAGGGCTATCCTCCGGTGGA
GTTTGCCACAGACAGGGTGGAGGAGCTCTTTGAGTGGTTTCAGAGCATCCGAGAGATCACCTGGAAGATT
GACACCAAGGAGAACAACATGAAGTACTGGGAGAAGAACCAGTCCATCGCCATCGAGCTCTCTGACCTGG
TTGTCTACTGCAAACCAACCAGCAAAACCAAGGACAACTTAGAAAATCCTGACTTCCGAGAAATCCGCTC
CTTTGTGGAGACGAAGGCTGACAGCATCATCAGACAGAAGCCCGTCGACCTCCTGAAGTACAATCAAAAG
GGCCTGACCCGCGTCTACCCAAAGGGACAAAGAGTTGACTCTTCAAACTACGACCCCTTCCGCCTCTGGC
TGTGCGGTTCTCAGATGGTGGCACTCAATTTCCAGACGGCAGATAAGTACATGCAGATGAATCACGCATT
GTTTTCTCTCAACGGGCGCACGGGCTACGTTCTGCAGCCTGAGAGCATGAGGACAGAGAAATATGACCCG
ATGCCACCCGAGTCCCAGAGGAAGATCCTGATGACGCTGACAGTCAAGGTTCTCGGTGCTCGCCATCTCC
CCAAACTTGGACGAAGTATTGCCTGTCCCTTTGTAGAAGTGGAGATCTGTGGAGCCGAGTATGACAACAA
CAAGTTCAAGACGACGGTTGTGAATGATAATGGCCTCAGCCCTATCTGGGCTCCAACACAGGAGAAGGTG
ACATTTGAAATTTATGACCCAAACCTGGCATTTCTGCGCTTTGTGGTTTATGAAGAAGATATGTTCAGCG
ATCCCAACTTTCTTGCTCATGCCACTTACCCCATTAAAGCAGTCAAATCAGGATTCAGGTCCGTTCCTCT
GAAGAATGGGTACAGCGAGGACATAGAGCTGGCTTCCCTCCTGGTTTTCTGTGAGATGCGGCCAGTCCTG
GAGAGCGAAGAGGAACTTTACTCCTCCTGTCGCCAGCTGAGGAGGCGGCAAGAAGAACTGAACAACCAGC
TCTTTCTGTATGACACACACCAGAACTTGCGCAATGCCAACCGGGATGCCCTGGTTAAAGAGTTCAGTGT
TAATGAGAACCAGCTCCAGCTGTACCAGGAGAAATGCAACAAGAGGTTAAGAGAGAAGAGAGTCAGCAAC
AGCAAGTTTTACTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200442 representing NM_002661
Red=Cloning site Green=Tags(s)

MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADKIEGFLDIMEI
KEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAVNWLSGLKILHQEAMNASTPT
IIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLM
FEQQKSILDEFKKDSSVFILGNTDRPDASAVYLRDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRET
AEPFLFVDEFLTYLFSRENSIWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLR
MGCRCIELDCWDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKA
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQK
WTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKRTSAEKLLQEYCMETGGKDGT
FLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYYLTDNLTFSSIYALIQHYRETHLRCAEFELR
LTDPVPNPNPHESKPWYYDSLSRGEAEDMLMRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGR
HFVLGTSAYFESLVELVSYYEKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMP
QRTVKALYDYKAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGYPPVEFATDRVEELFEWFQSIREITWKI
DTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETKADSIIRQKPVDLLKYNQK
GLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYMQMNHALFSLNGRTGYVLQPESMRTEKYDP
MPPESQRKILMTLTVKVLGARHLPKLGRSIACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKV
TFEIYDPNLAFLRFVVYEEDMFSDPNFLAHATYPIKAVKSGFRSVPLKNGYSEDIELASLLVFCEMRPVL
ESEEELYSSCRQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSN
SKFYS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002661
ORF Size 3795 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002661.2, NM_002661.3, NM_002661.4, NP_002652
RefSeq Size 4263
Locus ID 5336
Cytogenetics 16q23.3
Domains C2, PI-PLC-X, SH2, SH3, PI-PLC-Y, PH
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, ErbB signaling pathway, Calcium signaling pathway, Phosphatidylinositol signaling system, VEGF signaling pathway, Natural killer cell mediated cytotoxicity, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Vibrio cholerae infection, Epithelial cell signaling in Helicobacter pylori infection, Pathways in cancer, Glioma, Non-small cell lung cancer
MW 147.7 kDa
Gene Summary The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. It is a crucial enzyme in transmembrane signaling. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.