SYK (NM_003177) Human Tagged ORF Clone

CAT#: RC200413

Reviews ()
Write a review

SYK (Myc-DDK-tagged)-Human spleen tyrosine kinase (SYK), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SYK
Synonyms IMD82; p72-Syk
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200413 representing NM_003177
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAGCAGCGGCATGGCTGACAGCGCCAACCACCTGCCCTTCTTTTTCGGCAACATCACCCGGGAGG
AGGCAGAAGATTACCTGGTCCAGGGGGGCATGAGTGATGGGCTTTATTTGCTGCGCCAGAGCCGCAACTA
CCTGGGTGGCTTCGCCCTGTCCGTGGCCCACGGGAGGAAGGCACACCACTACACCATCGAGCGGGAGCTG
AATGGCACCTACGCCATCGCCGGTGGCAGGACCCATGCCAGCCCCGCCGACCTCTGCCACTACCACTCCC
AGGAGTCTGATGGCCTGGTCTGCCTCCTCAAGAAGCCCTTCAACCGGCCCCAAGGGGTGCAGCCCAAGAC
TGGGCCCTTTGAGGATTTGAAGGAAAACCTCATCAGGGAATATGTGAAGCAGACATGGAACCTGCAGGGT
CAGGCTCTGGAGCAGGCCATCATCAGTCAGAAGCCTCAGCTGGAGAAGCTGATCGCTACCACAGCCCATG
AAAAAATGCCTTGGTTCCATGGAAAAATCTCTCGGGAAGAATCTGAGCAAATTGTCCTGATAGGATCAAA
GACAAATGGAAAGTTCCTGATCCGAGCCAGAGACAACAACGGCTCCTACGCCCTGTGCCTGCTGCACGAA
GGGAAGGTGCTGCACTATCGCATCGACAAAGACAAGACAGGGAAGCTCTCCATCCCCGAGGGAAAGAAGT
TCGACACGCTCTGGCAGCTAGTCGAGCATTATTCTTATAAAGCAGATGGTTTGTTAAGAGTTCTTACTGT
CCCATGTCAAAAAATCGGCACACAGGGAAATGTTAATTTTGGAGGCCGTCCACAACTTCCAGGTTCCCAT
CCTGCGACTTGGTCAGCGGGTGGAATAATCTCAAGAATCAAATCATACTCCTTCCCAAAGCCTGGCCACA
GAAAGTCCTCCCCTGCCCAAGGGAACCGGCAAGAGAGTACTGTGTCATTCAATCCGTATGAGCCAGAACT
TGCACCCTGGGCTGCAGACAAAGGCCCCCAGAGAGAAGCCCTACCCATGGACACAGAGGTGTACGAGAGC
CCCTACGCGGACCCTGAGGAGATCAGGCCCAAGGAGGTTTACCTGGACCGAAAGCTGCTGACGCTGGAAG
ACAAAGAACTGGGCTCTGGTAATTTTGGAACTGTGAAAAAGGGCTACTACCAAATGAAAAAAGTTGTGAA
AACCGTGGCTGTGAAAATACTGAAAAACGAGGCCAATGACCCCGCTCTTAAAGATGAGTTATTAGCAGAA
GCAAATGTCATGCAGCAGCTGGACAACCCGTACATCGTGCGCATGATCGGGATATGCGAGGCCGAGTCCT
GGATGCTAGTTATGGAGATGGCAGAACTTGGTCCCCTCAATAAGTATTTGCAGCAGAACAGACATGTCAA
GGATAAGAACATCATAGAACTGGTTCATCAGGTTTCCATGGGCATGAAGTACTTGGAGGAGAGCAATTTT
GTGCACAGAGATCTGGCTGCAAGAAATGTGTTGCTAGTTACCCAACATTATGCCAAGATCAGTGATTTCG
GACTCTCCAAAGCACTGCGTGCTGATGAAAACTACTACAAGGCCCAGACCCATGGAAAGTGGCCTGTCAA
GTGGTACGCTCCGGAATGCATCAACTACTACAAGTTCTCCAGCAAAAGCGATGTCTGGAGCTTTGGAGTG
TTGATGTGGGAAGCATTCTCCTATGGGCAGAAGCCATATCGAGGGATGAAAGGAAGTGAAGTCACCGCTA
TGTTAGAGAAAGGAGAGCGGATGGGGTGCCCTGCAGGGTGTCCAAGAGAGATGTACGATCTCATGAATCT
GTGCTGGACATACGATGTGGAAAACAGGCCCGGATTCGCAGCAGTGGAACTGCGGCTGCGCAATTACTAC
TATGACGTGGTGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200413 representing NM_003177
Red=Cloning site Green=Tags(s)

MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHYTIEREL
NGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQG
QALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHE
GKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSH
PATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYES
PYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNF
VHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGV
LMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYY
YDVVN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003177
ORF Size 1905 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003177.3, NP_003168.2
RefSeq Size 2672 bp
RefSeq ORF 1908 bp
Locus ID 6850
UniProt ID P43405
Cytogenetics 9q22.2
Domains pkinase, SH2, TyrKc, S_TKc
Protein Families Druggable Genome, Protein Kinase
Protein Pathways B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Natural killer cell mediated cytotoxicity
MW 71.9 kDa
Gene Summary This gene encodes a member of the family of non-receptor type Tyr protein kinases. This protein is widely expressed in hematopoietic cells and is involved in coupling activated immunoreceptors to downstream signaling events that mediate diverse cellular responses, including proliferation, differentiation, and phagocytosis. It is thought to be a modulator of epithelial cell growth and a potential tumour suppressor in human breast carcinomas. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.