gamma Tubulin (TUBG1) (NM_001070) Human Tagged ORF Clone

CAT#: RC200408

Reviews ()
Write a review

TUBG1 (Myc-DDK-tagged)-Human tubulin, gamma 1 (TUBG1)



  "NM_001070" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TUBG1
Synonyms CDCBM4; GCP-1; TUBG; TUBGCP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200408 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGAGGGAAATCATCACCCTACAGTTGGGCCAGTGCGGCAATCAGATTGGGTTCGAGTTCTGGAAAC
AGCTGTGCGCCGAGCATGGTATCAGCCCCGAGGGCATCGTGGAGGAGTTCGCCACCGAGGGCACTGACCG
CAAGGACGTCTTTTTCTACCAGGCAGACGATGAGCACTACATCCCCCGGGCCGTGCTGCTGGACTTGGAA
CCCCGGGTGATCCACTCCATCCTCAACTCCCCCTATGCCAAGCTCTACAACCCAGAGAACATCTACCTGT
CGGAACATGGAGGAGGAGCTGGCAACAACTGGGCCAGCGGATTCTCCCAGGGAGAAAAGATCCATGAGGA
CATTTTTGACATCATAGACCGGGAGGCAGATGGTAGTGACAGTCTAGAGGGCTTTGTGCTGTGTCACTCC
ATTGCTGGGGGGACAGGCTCTGGACTGGGTTCCTACCTCTTAGAACGGCTGAATGACAGGTATCCTAAGA
AGCTGGTGCAGACATACTCAGTGTTTCCCAACCAGGACGAGATGAGCGATGTGGTGGTCCAGCCTTACAA
TTCACTCCTCACACTCAAGAGGCTGACGCAGAATGCAGACTGTGTGGTGGTGCTGGACAACACAGCCCTG
AACCGGATTGCCACAGACCGCCTGCACATCCAGAACCCATCCTTCTCCCAGATCAACCAGCTGGTGTCTA
CCATCATGTCAGCCAGCACCACCACCCTGCGCTACCCTGGCTACATGAACAATGACCTCATCGGCCTCAT
CGCCTCGCTCATTCCCACCCCACGGCTCCACTTCCTCATGACCGGCTACACCCCTCTCACTACGGACCAG
TCAGTGGCCAGCGTGAGGAAGACCACGGTCCTGGATGTCATGAGGCGGCTGCTGCAGCCCAAGAACGTGA
TGGTGTCCACAGGCCGAGACCGCCAGACCAACCACTGCTACATCGCCATCCTCAACATCATCCAGGGAGA
GGTGGACCCCACCCAGGTCCACAAGAGCTTGCAGAGGATCCGGGAACGCAAGTTGGCCAACTTCATCCCG
TGGGGCCCCGCCAGCATCCAGGTGGCCCTGTCGAGGAAGTCTCCCTACCTGCCCTCGGCCCACCGGGTCA
GCGGGCTCATGATGGCCAACCACACCAGCATCTCCTCGCTCTTCGAGAGAACCTGTCGCCAGTATGACAA
GCTGCGTAAGCGGGAGGCCTTCCTGGAGCAGTTCCGCAAGGAGGACATGTTCAAGGACAACTTTGATGAG
ATGGACACATCCAGGGAGATTGTGCAGCAGCTCATCGATGAGTACCATGCGGCCACACGGCCAGACTACA
TCTCCTGGGGCACCCAGGAGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200408 protein sequence
Red=Cloning site Green=Tags(s)

MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLE
PRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHS
IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTAL
NRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ
SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP
WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE
MDTSREIVQQLIDEYHAATRPDYISWGTQEQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001070
ORF Size 1353 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001070.5
RefSeq Size 1968 bp
RefSeq ORF 1356 bp
Locus ID 7283
UniProt ID P23258
Cytogenetics 17q21.2
Domains tubulin
Protein Families Druggable Genome
MW 51.2 kDa
Gene Summary This gene encodes a member of the tubulin superfamily. The encoded protein localizes to the centrosome where it binds to microtubules as part of a complex referred to as the gamma-tubulin ring complex. The protein mediates microtubule nucleation and is required for microtubule formation and progression of the cell cycle. A pseudogene of this gene is found on chromosome 7. [provided by RefSeq, Jan 2009]

Other Versions

Other products for "TUBG1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


Mouse Monoclonal anti-Tubulin-? Antibody
    • 25 ug

USD 209.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.