VAMP8 (NM_003761) Human Tagged ORF Clone

CAT#: RC200405

VAMP8 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 8 (endobrevin) (VAMP8)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_003761" in other vectors (6)

Reconstitution Protocol

USD 150.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit polyclonal anti-VAMP8 antibody (N-term)
    • 400 ul

USD 580.00

Other products for "VAMP8"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol VAMP8
Synonyms EDB; VAMP-8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200405 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAAGCCAGTGAAGGTGGAGGAAATGATCGTGTGCGGAACCTGCAAAGTGAGGTGGAGGGAGTTA
AGAATATTATGACCCAGAATGTGGAGCGGATCCTGGCCCGGGGGGAAAACTTGGAACATCTCCGCAACAA
GACAGAGGATCTGGAAGCCACATCTGAGCACTTCAAGACGACATCGCAGAAGGTGGCTCGGAAATTCTGG
TGGAAGAACGTGAAGATGATTGTCCTTATCTGCGTGATTGTTTTTATCATCATCCTCTTCATTGTGCTCT
TTGCCACTGGTGCCTTCTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200405 protein sequence
Red=Cloning site Green=Tags(s)

MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFW
WKNVKMIVLICVIVFIIILFIVLFATGAFS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003761
ORF Size 300 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_003761.2, NP_003752.2
RefSeq Size 790 bp
RefSeq ORF 303 bp
Locus ID 8673
UniProt ID Q9BV40
Cytogenetics 2p11.2
Domains synaptobrevin
Protein Families Stem cell - Pluripotency, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
MW 11.4 kDa
Gene Summary This gene encodes an integral membrane protein that belongs to the synaptobrevin/vesicle-associated membrane protein subfamily of soluble N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs). The encoded protein is involved in the fusion of synaptic vesicles with the presynaptic membrane.[provided by RefSeq, Jun 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.