Ezrin(EZR) (NM_003379) Human Tagged ORF Clone

CAT#: RC200404

EZR (Myc-DDK-tagged)-Human ezrin (EZR), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Ezrin(EZR) (NM_003379) Human Tagged ORF Clone
Symbol EZR
Synonyms CVIL; CVL; HEL-S-105; VIL2
Vector pCMV6-Entry
Sequence Data
>RC200404 representing NM_003379
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGAAACCAATCAATGTCCGAGTTACCACCATGGATGCAGAGCTGGAGTTTGCAATCCAGCCAAATA
CAACTGGAAAACAGCTTTTTGATCAGGTGGTAAAGACTATCGGCCTCCGGGAAGTGTGGTACTTTGGCCT
CCACTATGTGGATAATAAAGGATTTCCTACCTGGCTGAAGCTGGATAAGAAGGTGTCTGCCCAGGAGGTC
AGGAAGGAGAATCCCCTCCAGTTCAAGTTCCGGGCCAAGTTCTACCCTGAAGATGTGGCTGAGGAGCTCA
TCCAGGACATCACCCAGAAACTTTTCTTCCTCCAAGTGAAGGAAGGAATCCTTAGCGATGAGATCTACTG
CCCCCCTGAGACTGCCGTGCTCTTGGGGTCCTACGCTGTGCAGGCCAAGTTTGGGGACTACAACAAAGAA
GTGCACAAGTCTGGGTACCTCAGCTCTGAGCGGCTGATCCCTCAAAGAGTGATGGACCAGCACAAACTTA
CCAGGGACCAGTGGGAGGACCGGATCCAGGTGTGGCATGCGGAACACCGTGGGATGCTCAAAGATAATGC
TATGTTGGAATACCTGAAGATTGCTCAGGACCTGGAAATGTATGGAATCAACTATTTCGAGATAAAAAAC
AAGAAAGGAACAGACCTTTGGCTTGGAGTTGATGCCCTTGGACTGAATATTTATGAGAAAGATGATAAGT
TAACCCCAAAGATTGGCTTTCCTTGGAGTGAAATCAGGAACATCTCTTTCAATGACAAAAAGTTTGTCAT
TAAACCCATCGACAAGAAGGCACCTGACTTTGTGTTTTATGCCCCACGTCTGAGAATCAACAAGCGGATC
CTGCAGCTCTGCATGGGCAACCATGAGTTGTATATGCGCCGCAGGAAGCCTGACACCATCGAGGTGCAGC
AGATGAAGGCCCAGGCCCGGGAGGAGAAGCATCAGAAGCAGCTGGAGCGGCAACAGCTGGAAACAGAGAA
GAAAAGGAGAGAAACCGTGGAGAGAGAGAAAGAGCAGATGATGCGCGAGAAGGAGGAGTTGATGCTGCGG
CTGCAGGACTATGAGGAGAAGACAAAGAAGGCAGAGAGAGAGCTCTCGGAGCAGATTCAGAGGGCCCTGC
AGCTGGAGGAGGAGAGGAAGCGGGCACAGGAGGAGGCCGAGCGCCTAGAGGCTGACCGTATGGCTGCACT
GCGGGCTAAGGAGGAGCTGGAGAGACAGGCGGTGGATCAGATAAAGAGCCAGGAGCAGCTGGCTGCGGAG
CTTGCAGAATACACTGCCAAGATTGCCCTCCTGGAAGAGGCGCGGAGGCGCAAGGAGGATGAAGTTGAAG
AGTGGCAGCACAGGGCCAAAGAAGCCCAGGATGACCTGGTGAAGACCAAGGAGGAGCTGCACCTGGTGAT
GACAGCACCCCCGCCCCCACCACCCCCCGTGTACGAGCCGGTGAGCTACCATGTCCAGGAGAGCTTGCAG
GATGAGGGCGCAGAGCCCACGGGCTACAGCGCGGAGCTGTCTAGTGAGGGCATCCGGGATGACCGCAATG
AGGAGAAGCGCATCACTGAGGCAGAGAAGAACGAGCGTGTGCAGCGGCAGCTGCTGACGCTGAGCAGCGA
GCTGTCCCAGGCCCGAGATGAGAATAAGAGGACCCACAATGACATCATCCACAACGAGAACATGAGGCAA
GGCCGGGACAAGTACAAGACGCTGCGGCAGATCCGGCAGGGCAACACCAAGCAGCGCATCGACGAGTTCG
AGGCCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200404 representing NM_003379
Red=Cloning site Green=Tags(s)

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEV
RKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKE
VHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKN
KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI
LQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR
LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQ
DEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ
GRDKYKTLRQIRQGNTKQRIDEFEAL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003379
ORF Size 1758 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003379.1, NM_003379.2, NM_003379.3, NM_003379.4, NP_003370
RefSeq Size 3166
RefSeq ORF 1761
Locus ID 7430
Cytogenetics 6q25.3
Domains B41, ERM
Protein Families Druggable Genome
Protein Pathways Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Pathogenic Escherichia coli infection
MW 69.2 kDa
Gene Summary The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)