ETV5(ETV5) (NM_004454) Human Tagged ORF Clone

CAT#: RC200366

ETV5 (Myc-DDK-tagged)-Human ets variant 5 (ETV5)

Clone Modification / Custom Cloning Service

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ETV5(ETV5) (NM_004454) Human Tagged ORF Clone
Symbol ETV5
Synonyms ERM
Vector pCMV6-Entry
Sequence Data
>RC200366 representing NM_004454
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGGGTTTTATGATCAGCAAGTCCCTTTTATGGTCCCAGGGAAATCTCGATCTGAGGAATGCAGAG
GGCGGCCTGTGATTGACAGAAAGAGGAAGTTTTTGGACACAGATCTGGCTCACGATTCTGAAGAGCTATT
TCAGGATCTCAGTCAACTTCAAGAGGCTTGGTTAGCTGAAGCACAAGTTCCTGATGATGAACAGTTTGTC
CCAGATTTTCAGTCTGATAACCTGGTGCTTCATGCCCCACCTCCAACCAAGATCAAACGGGAGCTGCACA
GCCCCTCCTCTGAGCTGTCGTCTTGTAGCCATGAGCAGGCTCTTGGTGCTAACTATGGAGAAAAGTGCCT
CTACAACTATTGTGCCTATGATAGGAAGCCTCCCTCTGGGTTCAAGCCATTAACCCCTCCTACAACCCCC
CTCTCACCCACCCATCAGAATCCCCTATTTCCCCCACCTCAGGCAACTCTGCCCACCTCAGGGCATGCCC
CTGCAGCTGGCCCAGTTCAAGGTGTGGGCCCCGCCCCCGCCCCCCATTCGCTTCCAGAGCCTGGACCACA
GCAGCAAACATTTGCGGTCCCCCGACCACCACATCAGCCCCTGCAGATGCCAAAGATGATGCCTGAAAAC
CAGTATCCATCAGAACAGAGATTTCAGAGACAACTGTCTGAACCCTGCCACCCCTTCCCTCCTCAGCCAG
GAGTTCCTGGAGATAATCGCCCCAGTTACCATCGGCAAATGTCAGAACCTATTGTCCCTGCAGCTCCCCC
GCCCCCTCAGGGATTCAAACAAGAATACCATGACCCACTCTATGAACATGGGGTCCCGGGCATGCCAGGG
CCCCCAGCACACGGGTTCCAGTCACCAATGGGAATCAAGCAGGAGCCTCGGGATTACTGCGTCGATTCAG
AAGTGCCTAACTGCCAGTCATCCTACATGAGAGGGGGTTATTTCTCCAGCAGCCATGAAGGTTTTTCATA
TGAAAAAGATCCCCGATTATACTTTGACGACACTTGTGTTGTGCCTGAGAGACTGGAAGGCAAAGTCAAA
CAGGAGCCTACCATGTATCGAGAGGGGCCCCCTTACCAGAGGCGAGGTTCCCTTCAGCTGTGGCAGTTCC
TGGTCACCCTTCTTGATGACCCAGCCAATGCCCACTTCATTGCCTGGACAGGTCGAGGCATGGAGTTCAA
GCTGATAGAACCGGAAGAGGTTGCTCGGCGCTGGGGCATCCAGAAGAACCGGCCAGCCATGAACTATGAC
AAGCTGAGCCGCTCTCTCCGCTATTACTATGAAAAGGGCATCATGCAGAAGGTGGCTGGAGAGCGATACG
TCTACAAATTTGTCTGTGACCCAGATGCCCTCTTCTCCATGGCTTTCCCGGATAACCAGCGTCCGTTCCT
GAAGGCAGAGTCCGAGTGCCACCTCAGCGAGGAGGACACCCTGCCGCTGACCCACTTTGAAGACAGCCCC
GCTTACCTCCTGGACATGGACCGCTGCAGCAGCCTCCCCTATGCCGAAGGCTTTGCTTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200366 representing NM_004454
Red=Cloning site Green=Tags(s)

MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFV
PDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTP
LSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPEN
QYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPG
PPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVK
QEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYD
KLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSP
AYLLDMDRCSSLPYAEGFAY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004454
ORF Size 1530 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004454.1, NM_004454.2, NP_004445
RefSeq Size 4071
RefSeq ORF 1533
Locus ID 2119
Cytogenetics 3q27.2
Domains ETS, ETS_PEA3_N
Protein Families Transcription Factors
MW 57.7 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)