Ferredoxin Reductase (FDXR) (NM_024417) Human Tagged ORF Clone

CAT#: RC200363

Reviews ()
Write a review

FDXR (Myc-DDK-tagged)-Human ferredoxin reductase (FDXR), nuclear gene encoding mitochondrial protein, transcript variant 1



Reconstitution Protocol

USD 457.00

USD 686.00

In Stock*

Size
    • 10 ug

Product images

Other products for "FDXR"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FDXR
Synonyms ADR; ADXR; ANOA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200363 representing NM_024417
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCGCGCTGCTGGCGCTGGTGGGGCTGGTCGGCGTGGCCTCGGACCCGGCTGCCTCCCGCCGGGA
GCACCCCGAGCTTCTGCCACCATTTCTCCACACAGGAGAAGACCCCCCAGATCTGTGTGGTGGGCAGTGG
CCCAGCTGGCTTCTACACGGCCCAACACCTGCTAAAGCACCCCCAGGCCCACGTGGACATCTACGAGAAA
CAGCCTGTGCCCTTTGGCCTGGTGCGCTTTGGTGTGGCGCCTGATCACCCCGAGGTGAAGAATGTCATCA
ACACATTTACCCAGACGGCCCATTCTGGCCGCTGTGCCTTCTGGGGCAACGTGGAGGTGGGCAGGGACGT
GACGGTGCCGGAGCTGCGGGAGGCCTACCACGCTGTGGTGCTGAGCTACGGGGCAGAGGACCATCGGGCC
CTGGAAATTCCTGGTGAGGAGCTGCCAGGTGTGTGCTCCGCCCGGGCCTTCGTGGGCTGGTACAACGGGC
TTCCTGAGAACCAGGAGCTGGAGCCAGACCTGAGCTGTGACACAGCCGTGATTCTGGGGCAGGGGAACGT
GGCTCTGGACGTGGCCCGCATCCTACTGACCCCACCTGAGCACCTGGAGAGAACGGACATCACGAAGGCA
GCCCTGGGTGTACTGAGGCAGAGTCGAGTGAAGACAGTGTGGCTAGTGGGCCGGCGTGGACCCCTGCAAG
TGGCCTTCACCATTAAGGAGCTTCGGGAGATGATTCAGTTACCGGGAGCCCGGCCCATTTTGGATCCTGT
GGATTTCTTGGGTCTCCAGGACAAGATCAAGGAGGTCCCCCGCCCGAGGAAGCGGCTGACGGAACTGCTG
CTTCGAACGGCCACAGAGAAGCCAGGGCCGGCGGAAGCTGCCCGCCAGGCATCGGCCTCCCGTGCCTGGG
GCCTCCGCTTTTTCCGAAGCCCCCAGCAGGTGCTGCCCTCACCAGATGGGCGGCGGGCAGCAGGTGTCCG
CCTAGCAGTCACTAGACTGGAGGGTGTCGATGAGGCCACCCGTGCAGTGCCCACGGGAGACATGGAAGAC
CTCCCTTGTGGGCTGGTGCTCAGCAGCATTGGGTATAAGAGCCGCCCTGTCGACCCAAGCGTGCCCTTTG
ACTCCAAGCTTGGGGTCATCCCCAATGTGGAGGGCCGGGTTATGGATGTGCCAGGCCTCTACTGCAGCGG
CTGGGTGAAGAGAGGACCTACAGGTGTCATAGCCACAACCATGACTGACAGCTTCCTCACCGGCCAGATG
CTGCTGCAGGACCTGAAGGCTGGGTTGCTCCCCTCTGGCCCCAGGCCTGGCTACGCAGCCATCCAGGCCC
TGCTCAGCAGCCGAGGGGTCCGGCCAGTCTCTTTCTCAGACTGGGAGAAGCTGGATGCCGAGGAGGTGGC
CCGGGGCCAGGGCACGGGGAAGCCCAGGGAGAAGCTGGTGGATCCTCAGGAGATGCTGCGCCTCCTGGGC
CAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200363 representing NM_024417
Red=Cloning site Green=Tags(s)

MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKHPQAHVDIYEK
QPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYGAEDHRA
LEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKA
ALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELL
LRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMED
LPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM
LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLG
H

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024417
ORF Size 1473 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024417.3
RefSeq Size 1918 bp
RefSeq ORF 1476 bp
Locus ID 2232
UniProt ID P22570
Cytogenetics 17q25.1
Protein Families Druggable Genome
MW 49.9 kDa
Gene Summary This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.