NFAT4 (NFATC3) (NM_173165) Human Tagged ORF Clone

CAT#: RC200357

Reviews ()
Write a review

NFATC3 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (NFATC3), transcript variant 1



  "NM_173165" in other vectors (6)

Reconstitution Protocol

USD 936.00

USD 1,403.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "NFATC3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NFATC3
Synonyms NF-AT4c; NFAT4; NFATX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200357 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTACTGCAAACTGTGGCGCCCACGACGAGCTCGACTTCAAACTCGTCTTTGGCGAGGACGGGGCGC
CGGCGCCGCCGCCCCCGGGCTCGCGGCCTGCAGATCTTGAGCCAGATGATTGTGCATCCATTTACATCTT
TAATGTAGATCCACCTCCATCTACTTTAACCACACCACTTTGCTTACCACATCATGGATTACCGTCTCAC
TCTTCTGTTTTGTCACCATCGTTTCAGCTCCAAAGTCACAAAAACTATGAAGGAACTTGTGAGATTCCTG
AATCTAAATATAGCCCATTAGGTGGTCCCAAACCCTTTGAGTGCCCAAGTATTCAAATTACATCTATCTC
TCCTAACTGTCATCAAGAATTAGATGCACATGAAGATGACCTACAGATAAATGACCCAGAACGGGAATTT
TTGGAAAGGCCTTCTAGAGATCATCTCTATCTTCCTCTTGAGCCATCCTACCGGGAGTCTTCTCTTAGTC
CTAGTCCTGCCAGCAGCATCTCTTCTAGGAGTTGGTTCTCTGATGCATCTTCTTGTGAATCGCTTTCACA
TATTTATGATGATGTGGACTCAGAGTTGAATGAAGCTGCAGCCCGATTTACCCTTGGATCCCCTCTGACT
TCTCCTGGTGGCTCTCCAGGGGGCTGCCCTGGAGAAGAAACTTGGCATCAACAGTATGGACTTGGACACT
CATTATCACCCAGGCAATCTCCTTGCCACTCTCCTAGATCCAGTGTCACTGATGAGAATTGGCTGAGCCC
CAGGCCAGCCTCAGGACCCTCATCAAGGCCCACATCCCCCTGTGGGAAACGGAGGCACTCCAGTGCTGAA
GTTTGTTATGCTGGGTCCCTTTCACCCCATCACTCACCTGTTCCTTCACCTGGTCACTCCCCCAGGGGAA
GTGTGACAGAAGATACGTGGCTCAATGCTTCTGTCCATGGTGGGTCAGGCCTTGGCCCTGCAGTTTTTCC
ATTTCAGTACTGTGTAGAGACTGACATCCCTCTCAAAACAAGGAAAACTTCTGAAGATCAAGCTGCCATA
CTACCAGGAAAATTAGAGCTGTGTTCAGATGACCAAGGGAGTTTATCACCAGCCCGGGAGACTTCAATAG
ATGATGGCCTTGGATCTCAGTATCCTTTAAAGAAAGATTCATGTGGTGATCAGTTTCTTTCAGTTCCTTC
ACCCTTTACCTGGAGCAAACCAAAGCCTGGCCACACCCCTATATTTCGCACATCTTCATTACCTCCACTA
GACTGGCCTTTACCAGCTCATTTTGGACAATGTGAACTGAAAATAGAAGTGCAACCTAAAACTCATCATC
GAGCCCATTATGAAACTGAAGGTAGCCGAGGGGCAGTAAAAGCATCTACTGGGGGACATCCTGTTGTGAA
GCTCCTGGGCTATAACGAAAAGCCAATAAATCTACAAATGTTTATTGGGACAGCAGATGATCGATATTTA
CGACCTCATGCATTTTACCAGGTGCATCGAATCACTGGGAAGACAGTCGCTACTGCAAGCCAAGAGATAA
TAATTGCCAGTACAAAAGTTCTGGAAATTCCACTTCTTCCTGAAAATAATATGTCAGCCAGTATTGATTG
TGCAGGTATTTTGAAACTCCGCAATTCAGATATAGAACTTCGAAAAGGAGAAACTGATATTGGCAGAAAG
AATACTAGAGTACGACTTGTGTTTCGTGTACACATCCCACAGCCCAGTGGAAAAGTCCTTTCTCTGCAGA
TAGCCTCTATACCCGTTGAGTGCTCCCAGCGGTCTGCTCAAGAACTTCCTCATATTGAGAAGTACAGTAT
CAACAGTTGTTCTGTAAATGGAGGTCATGAAATGGTTGTGACTGGATCTAATTTTCTTCCAGAATCCAAA
ATCATTTTTCTTGAAAAAGGACAAGATGGACGACCTCAGTGGGAGGTAGAAGGGAAGATAATCAGGGAAA
AATGTCAAGGGGCTCACATTGTCCTTGAAGTTCCTCCATATCATAACCCAGCAGTTACAGCTGCAGTGCA
GGTGCACTTTTATCTTTGCAATGGCAAGAGGAAAAAAAGCCAGTCTCAACGTTTTACTTATACACCAGTT
TTGATGAAGCAAGAACACAGAGAAGAGATTGATTTGTCTTCAGTTCCATCTTTGCCTGTGCCTCATCCTG
CTCAGACCCAGAGGCCTTCCTCTGATTCAGGGTGTTCACATGACAGTGTACTGTCAGGACAGAGAAGTTT
GATTTGCTCCATCCCACAAACATATGCATCCATGGTGACCTCATCCCATCTGCCACAGTTGCAGTGTAGA
GATGAGAGTGTTAGTAAAGAACAGCATATGATTCCTTCTCCAATTGTACACCAGCCTTTTCAAGTCACAC
CAACACCTCCTGTGGGGTCTTCCTATCAGCCTATGCAAACTAATGTTGTGTACAATGGACCAACTTGTCT
TCCTATTAATGCTGCCTCTAGTCAAGAATTTGATTCAGTTTTGTTTCAGCAGGATGCAACTCTTTCTGGT
TTAGTGAATCTTGGCTGTCAACCACTGTCATCCATACCATTTCATTCTTCAAATTCAGGCTCAACAGGAC
ATCTCTTAGCCCATACACCTCATTCTGTGCATACCCTGCCTCATCTGCAATCAATGGGATATCATTGTTC
AAATACAGGACAAAGATCTCTTTCTTCTCCAGTGGCTGACCAGATTACAGGTCAGCCTTCGTCTCAGTTA
CAACCTATTACATATGGTCCTTCACATTCAGGGTCTGCTACAACAGCTTCCCCAGCAGCTTCTCATCCCT
TGGCTAGTTCACCGCTTTCTGGGCCACCATCTCCTCAGCTTCAGCCTATGCCTTACCAATCTCCTAGCTC
AGGAACTGCCTCATCACCGTCTCCAGCCACCAGAATGCATTCTGGACAGCACTCAACTCAAGCACAAAGT
ACGGGCCAGGGGGGTCTTTCTGCACCTTCATCCTTAATATGTCACAGTTTGTGTGATCCAGCGTCATTTC
CACCTGATGGGGCAACTGTGAGCATTAAACCTGAACCAGAAGATCGAGAGCCTAACTTTGCAACCATTGG
TCTGCAGGACATCACTTTAGATGATGTGAACGAGATAATTGGGAGAGACATGTCCCAGATTTCTGTTTCC
CAAGGAGCAGGGGTGAGCAGGCAGGCTCCCCTCCCGAGTCCTGAGTCCCTGGATTTAGGAAGATCTGATG
GGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200357 protein sequence
Red=Cloning site Green=Tags(s)

MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLTTPLCLPHHGLPSH
SSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREF
LERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAAARFTLGSPLT
SPGGSPGGCPGEETWHQQYGLGHSLSPRQSPCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAE
VCYAGSLSPHHSPVPSPGHSPRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAI
LPGKLELCSDDQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQMFIGTADDRYL
RPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRK
NTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELPHIEKYSINSCSVNGGHEMVVTGSNFLPESK
IIFLEKGQDGRPQWEVEGKIIREKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPV
LMKQEHREEIDLSSVPSLPVPHPAQTQRPSSDSGCSHDSVLSGQRSLICSIPQTYASMVTSSHLPQLQCR
DESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSG
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQPSSQL
QPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQS
TGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDVNEIIGRDMSQISVS
QGAGVSRQAPLPSPESLDLGRSDGL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_173165
ORF Size 3225 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_173165.3
RefSeq Size 6349 bp
RefSeq ORF 3228 bp
Locus ID 4775
UniProt ID Q12968
Cytogenetics 16q22.1
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Axon guidance, B cell receptor signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway
MW 115.6 kDa
Gene Summary The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Nov 2010]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.