TRAF4 (NM_004295) Human Tagged ORF Clone

CAT#: RC200345

Reviews ()
Write a review

TRAF4 (Myc-DDK-tagged)-Human TNF receptor-associated factor 4 (TRAF4)



  "NM_004295" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00

USD 686.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "TRAF4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRAF4
Synonyms CART1; MLN62; RNF83
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200345 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGGCTTCGACTACAAGTTCCTGGAGAAGCCCAAGCGACGGCTGCTGTGCCCACTGTGCGGGAAGC
CCATGCGCGAGCCTGTGCAGGTTTCCACCTGCGGCCACCGTTTCTGCGATACCTGCCTGCAGGAGTTCCT
CAGTGAAGGAGTCTTCAAGTGCCCTGAGGACCAGCTTCCTCTGGACTATGCCAAGATCTACCCAGACCCG
GAGCTGGAAGTACAAGTATTGGGCCTGCCTATCCGCTGCATCCACAGTGAGGAGGGCTGCCGCTGGAGTG
GGCCACTACGTCATCTACAGGGCCACCTGAATACCTGCAGCTTCAATGTCATTCCCTGCCCTAATCGCTG
CCCCATGAAGCTGAGCCGCCGTGATCTACCTGCACACTTGCAGCATGACTGCCCCAAGCGGCGCCTCAAG
TGCGAGTTTTGTGGCTGTGACTTCAGTGGGGAGGCCTATGAGAGCCATGAGGGTATGTGCCCCCAGGAGA
GTGTCTACTGTGAGAATAAGTGTGGTGCCCGCATGATGCGGCGGCTGCTGGCCCAGCATGCCACCTCTGA
GTGCCCCAAGCGCACTCAGCCCTGCACCTACTGCACTAAGGAGTTCGTCTTTGACACCATCCAGAGCCAC
CAGTACCAGTGCCCAAGGCTGCCTGTTGCCTGCCCCAACCAATGTGGTGTGGGCACTGTGGCTCGGGAGG
ACCTGCCAGGCCATCTGAAGGACAGCTGTAACACCGCCCTGGTGCTCTGCCCATTCAAAGACTCCGGCTG
CAAGCACAGGTGCCCTAAGCTGGCAATGGCACGGCATGTGGAGGAGAGTGTGAAGCCACATCTGGCCATG
ATGTGTGCCCTGGTGAGCCGGCAACGGCAGGAGCTGCAGGAGCTTCGGCGAGAGCTGGAGGAGCTATCAG
TGGGCAGTGATGGCGTGCTCATCTGGAAGATTGGCAGCTATGGACGGCGGCTACAGGAGGCCAAGGCCAA
GCCCAACCTTGAGTGCTTCAGCCCAGCCTTCTACACACATAAGTATGGTTACAAGCTGCAGGTGTCTGCA
TTCCTCAATGGCAATGGCAGTGGTGAGGGCACACACCTCTCACTGTACATTCGTGTGCTGCCTGGTGCCT
TTGACAATCTCCTTGAGTGGCCCTTTGCCCGCCGTGTCACCTTCTCCCTGCTGGATCAGAGCGACCCTGG
GCTGGCTAAACCACAGCACGTCACTGAGACCTTCCACCCCGACCCAAACTGGAAGAATTTCCAGAAGCCA
GGCACGTGGCGGGGCTCCCTGGATGAGAGTTCTCTGGGCTTTGGTTATCCCAAGTTCATCTCCCACCAGG
ACATTCGAAAGCGAAACTATGTGCGGGATGATGCAGTCTTCATCCGTGCTGCTGTTGAACTGCCCCGGAA
GATCCTCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200345 protein sequence
Red=Cloning site Green=Tags(s)

MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDP
ELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLK
CEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSH
QYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAM
MCALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSA
FLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004295
ORF Size 1410 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004295.4
RefSeq Size 2902 bp
RefSeq ORF 1413 bp
Locus ID 9618
UniProt ID Q9BUZ4
Cytogenetics 17q11.2
Domains zf-TRAF, RING, MATH
Protein Families Druggable Genome
Protein Pathways Pathways in cancer, Small cell lung cancer
MW 53.5 kDa
Gene Summary This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


TRAF4 rabbit polyclonal antibody
    • 25 ul

USD 800.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.