KCNJ8 (NM_004982) Human Tagged ORF Clone

CAT#: RC200340

Reviews ()
Write a review

KCNJ8 (Myc-DDK-tagged)-Human potassium inwardly-rectifying channel, subfamily J, member 8 (KCNJ8)


  "NM_004982" in other vectors (7)

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name KCNJ8 (NM_004982) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNJ8
Synonyms KIR6.1; uKATP-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200340 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGCCAGAAAGAGTATCATCCCGGAGGAGTATGTGCTGGCGCGCATCGCCGCAGAGAACCTGCGCA
AGCCGCGCATCCGAGACCGCCTCCCCAAAGCCCGCTTCATCGCCAAGAGCGGGGCCTGCAACCTGGCGCA
TAAGAACATCCGTGAGCAAGGACGCTTTCTACAGGACATCTTCACCACCTTGGTGGACCTGAAATGGCGC
CACACGCTGGTCATCTTTACCATGTCCTTCCTCTGCAGCTGGCTGCTCTTCGCTATCATGTGGTGGCTGG
TGGCCTTTGCCCATGGGGACATCTATGCTTACATGGAGAAAAGTGGAATGGAGAAAAGTGGTTTGGAGTC
CACTGTGTGTGTGACTAATGTCAGGTCTTTCACTTCTGCTTTTCTCTTCTCCATTGAAGTTCAAGTTACC
ATTGGGTTTGGAGGGAGGATGATGACAGAGGAATGCCCTTTGGCCATCACGGTTTTGATTCTCCAGAATA
TTGTGGGTTTGATCATCAATGCAGTCATGTTAGGCTGCATTTTCATGAAAACAGCTCAGGCTCACAGAAG
GGCAGAAACTTTGATTTTCAGCCGCCATGCTGTGATTGCCGTCCGAAATGGCAAGCTGTGCTTCATGTTC
CGAGTGGGTGACCTGAGGAAAAGCATGATCATTAGTGCCTCTGTGCGCATCCAGGTGGTCAAGAAAACAA
CTACACCTGAAGGGGAGGTGGTTCCTATTCACCAACTGGACATTCCTGTTGATAACCCAATCGAGAGCAA
TAACATTTTTCTGGTGGCCCCTTTGATCATCTGCCACGTGATTGACAAGCGCAGTCCCCTGTATGACATC
TCAGCAACTGACCTGGCCAACCAAGACTTGGAGGTCATAGTTATTCTGGAAGGAGTGGTTGAAACTACTG
GCATCACCACACAAGCACGAACCTCCTACATTGCTGAGGAGATCCAATGGGGCCACCGCTTTGTGTCCAT
TGTGACTGAGGAAGAAGGAGTGTATTCTGTGGATTACTCCAAATTTGGCAACACTGTTAAAGTAGCTGCT
CCACGGTGCAGTGCCCGAGAGCTGGATGAGAAACCTTCCATCCTTATTCAGACCCTCCAAAAGAGTGAAC
TGTCTCATCAAAATTCTCTGAGGAAGCGCAACTCCATGAGAAGAAACAATTCCATGAGGAGGAACAATTC
TATCCGAAGGAACAATTCTTCCCTCATGGTACCAAAGGTGCAATTTATGACTCCAGAAGGAAATCAAAAC
ACATCGGAATCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200340 protein sequence
Red=Cloning site Green=Tags(s)

MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDIFTTLVDLKWR
HTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSGLESTVCVTNVRSFTSAFLFSIEVQVT
IGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMKTAQAHRRAETLIFSRHAVIAVRNGKLCFMF
RVGDLRKSMIISASVRIQVVKKTTTPEGEVVPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDI
SATDLANQDLEVIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAA
PRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQN
TSES

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004982
ORF Size 1272 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004982.1, NM_004982.2, NM_004982.3, NP_004973.1
RefSeq Size 2406
RefSeq ORF 1275
Locus ID 3764
Cytogenetics 12p12.1
Domains IRK
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
MW 48 kDa
Gene Summary Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. Defects in this gene may be a cause of J-wave syndromes and sudden infant death syndrome (SIDS). [provided by RefSeq, May 2012]

Other Versions

Other products for "KCNJ8"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-KCNJ8 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools