APEX2 (NM_014481) Human Tagged ORF Clone

CAT#: RC200320

Reviews ()
Write a review

APEX2 (Myc-DDK-tagged)-Human APEX nuclease (apurinic/apyrimidinic endonuclease) 2 (APEX2), nuclear gene encoding mitochondrial protein



Reconstitution Protocol

USD 482.00

USD 723.00

In Stock*

Size
    • 10 ug

Product images

Other products for "APEX2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol APEX2
Synonyms APE2; APEXL2; XTH2; ZGRF2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200320 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGCGCGTGGTGAGCTGGAACATCAATGGGATTCGGAGACCCCTGCAAGGGGTGGCAAATCAGGAAC
CCAGCAACTGTGCCGCCGTGGCCGTGGGGCGCATTTTGGACGAGCTGGATGCGGATATCGTCTGTCTCCA
GGAAACCAAAGTGACCAGGGATGCACTGACAGAGCCCCTGGCTATCGTTGAGGGTTATAACTCCTATTTC
AGCTTCAGCCGCAACCGTAGCGGCTATTCTGGTGTAGCCACCTTCTGTAAGGACAATGCTACCCCAGTGG
CTGCTGAAGAAGGCCTGAGTGGCCTGTTTGCCACCCAGAATGGGGATGTTGGTTGCTATGGAAACATGGA
TGAGTTTACCCAAGAGGAACTCCGGGCTCTGGATAGTGAGGGCAGGGCCCTCCTCACACAGCATAAGATC
CGCACATGGGAAGGTAAGGAGAAGACCTTGACCCTAATCAACGTGTACTGCCCCCATGCGGACCCTGGGA
GGCCTGAGCGGCTAGTCTTTAAGATGCGCTTCTATCGTTTGCTGCAAATCCGAGCAGAAGCCCTCCTGGC
GGCAGGCAGCCATGTGATCATTCTGGGTGACCTGAATACAGCCCACCGCCCCATTGACCACTGGGATGCA
GTCAACCTGGAATGCTTTGAAGAGGACCCAGGGCGCAAGTGGATGGACAGCTTGCTCAGTAACTTGGGGT
GCCAGTCTGCCTCTCATGTAGGGCCCTTCATCGATAGCTACCGCTGCTTCCAACCAAAGCAGGAGGGGGC
CTTCACCTGCTGGTCAGCAGTCACTGGCGCCCGCCATCTCAACTATGGCTCCCGGCTTGACTATGTGCTG
GGGGACAGGACCCTGGTCATAGACACCTTTCAGGCCTCTTTCCTGCTGCCTGAGGTGATGGGCTCTGACC
ACTGCCCTGTGGGTGCAGTCTTGAGTGTGTCCTCTGTGCCTGCAAAACAGTGCCCACCTCTGTGCACCCG
CTTCCTCCCTGAGTTTGCAGGCACCCAGCTCAAGATCCTTCGCTTCCTAGTTCCTCTCGAACAAAGTCCT
GTGTTGGAGCAGTCGACGCTGCAGCACAACAATCAAACCCGGGTACAGACATGCCAAAACAAAGCCCAAG
TGCGCTCAACCAGGCCTCAGCCCAGTCAGGTTGGCTCTAGCAGAGGCCAGAAAAACCTGAAGAGCTACTT
TCAGCCCTCCCCTAGCTGTCCCCAAGCCTCTCCTGACATAGAGCTGCCTAGCCTACCACTGATGAGCGCC
CTCATGACCCCGAAGACTCCAGAAGAGAAGGCAGTGGCCAAAGTGGTGAAGGGGCAGGCCAAGACTTCAG
AAGCCAAAGATGAGAAGGAGTTACGGACCTCATTCTGGAAGTCTGTGCTGGCGGGGCCCTTGCGCACACC
CCTCTGTGGGGGCCACAGGGAGCCATGTGTGATGCGTACTGTGAAGAAGCCAGGACCCAACTTGGGCCGC
CGCTTCTACATGTGTGCCAGGCCCCGGGGTCCTCCCACTGACCCCTCCTCCCGGTGCAACTTCTTCCTCT
GGAGCAGGCCCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200320 protein sequence
Red=Cloning site Green=Tags(s)

MLRVVSWNINGIRRPLQGVANQEPSNCAAVAVGRILDELDADIVCLQETKVTRDALTEPLAIVEGYNSYF
SFSRNRSGYSGVATFCKDNATPVAAEEGLSGLFATQNGDVGCYGNMDEFTQEELRALDSEGRALLTQHKI
RTWEGKEKTLTLINVYCPHADPGRPERLVFKMRFYRLLQIRAEALLAAGSHVIILGDLNTAHRPIDHWDA
VNLECFEEDPGRKWMDSLLSNLGCQSASHVGPFIDSYRCFQPKQEGAFTCWSAVTGARHLNYGSRLDYVL
GDRTLVIDTFQASFLLPEVMGSDHCPVGAVLSVSSVPAKQCPPLCTRFLPEFAGTQLKILRFLVPLEQSP
VLEQSTLQHNNQTRVQTCQNKAQVRSTRPQPSQVGSSRGQKNLKSYFQPSPSCPQASPDIELPSLPLMSA
LMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCGGHREPCVMRTVKKPGPNLGR
RFYMCARPRGPPTDPSSRCNFFLWSRPS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014481
ORF Size 1554 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014481.4
RefSeq Size 2095 bp
RefSeq ORF 1557 bp
Locus ID 27301
UniProt ID Q9UBZ4
Cytogenetics Xp11.21
Protein Families Druggable Genome
Protein Pathways Base excision repair
MW 57.4 kDa
Gene Summary Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes a protein shown to have a weak class II AP endonuclease activity. Most of the encoded protein is located in the nucleus but some is also present in mitochondria. This protein may play an important role in both nuclear and mitochondrial base excision repair. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.