INSIG1 (NM_005542) Human Tagged ORF Clone

SKU
RC200312
INSIG1 (Myc-DDK-tagged)-Human insulin induced gene 1 (INSIG1), transcript variant 1
  $300.00
In Stock*
Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol INSIG1
Synonyms CL6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200312 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCAGATTGCACGACCACTTCTGGAGCTGCTCCTGTGCGCACAGCGCGAGGCGCCGAGGCCCCCCGC
GAGCCAGCGCCGCGGGGCTGGCGGCCAAGGTTGGGGAGATGATCAACGTTTCCGTGTCCGGGCCCTCCCT
GCTGGCGGCCCACGGTGCCCCGGACGCTGACCCCGCGCCCAGGGGCCGCAGTGCTGCGATGAGCGGCCCC
GAGCCCGGCAGCCCCTACCCCAACACCTGGCATCATCGCCTGTTGCAGAGGAGCCTCGTGCTCTTCTCGG
TTGGGGTGGTCCTAGCCCTGGTGCTCAACCTGCTGCAGATCCAGAGGAATGTCACTCTCTTCCCCGAGGA
GGTGATCGCCACCATCTTTTCCTCCGCCTGGTGGGTCCCTCCCTGCTGCGGGACAGCAGCTGCTGTTGTT
GGCCTACTGTACCCCTGTATCGACAGTCACCTCGGAGAACCCCACAAATTTAAGAGAGAATGGGCCAGTG
TCATGCGCTGCATAGCAGTTTTTGTTGGCATTAACCACGCCAGTGCTAAATTGGATTTTGCCAATAATGT
CCAGCTGTCCTTGACTTTAGCAGCCCTATCTTTGGGCCTTTGGTGGACATTTGATCGTTCCAGAAGTGGC
CTTGGGCTGGGGATCACCATAGCTTTTCTAGCTACGCTGATCACGCAGTTTCTCGTGTATAATGGTGTCT
ATCAGTATACATCCCCAGATTTCCTCTATATTCGTTCTTGGCTCCCTTGTATATTTTTCTCAGGAGGCGT
CACGGTGGGGAACATAGGACGACAGTTAGCTATGGGTGTTCCTGAAAAGCCCCATAGTGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200312 protein sequence
Red=Cloning site Green=Tags(s)

MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGP
EPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVV
GLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSG
LGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005542
ORF Size 831 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005542.6
RefSeq Size 3020 bp
RefSeq ORF 834 bp
Locus ID 3638
UniProt ID O15503
Cytogenetics 7q36.3
Protein Families Druggable Genome, Transmembrane
MW 30 kDa
Summary This gene encodes an endoplasmic reticulum membrane protein that regulates cholesterol metabolism, lipogenesis, and glucose homeostasis. The encoded protein has six transmembrane helices which contain an effector protein binding site. It binds the sterol-sensing domains of sterol regulatory element-binding protein (SREBP) cleavage-activating protein (SCAP) and 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase), and is essential for the sterol-mediated trafficking of these two proteins. It promotes the endoplasmic reticulum retention of SCAP and the ubiquitin-mediated degradation of HMG-CoA reductase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_005542" in other vectors (6)
SKU Description Size Price
RC200312L1 Lenti ORF clone of Human insulin induced gene 1 (INSIG1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200312L2 Lenti ORF clone of Human insulin induced gene 1 (INSIG1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC200312L3 Lenti ORF clone of Human insulin induced gene 1 (INSIG1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200312L4 Lenti ORF clone of Human insulin induced gene 1 (INSIG1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG200312 INSIG1 (tGFP-tagged) - Human insulin induced gene 1 (INSIG1), transcript variant 1 10 ug
$489.00 $500.00
SC116677 INSIG1 (untagged)-Human insulin induced gene 1 (INSIG1), transcript variant 1 10 ug
$300.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.