Lysyl tRNA synthetase (KARS) (NM_005548) Human Tagged ORF Clone

CAT#: RC200311

Reviews ()
Write a review

KARS (Myc-DDK-tagged)-Human lysyl-tRNA synthetase (KARS), transcript variant 2



Reconstitution Protocol

USD 556.00

USD 833.00

In Stock*

Size
    • 10 ug

Product images

Other products for "KARS"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KARS
Synonyms CMTRIB; DEAPLE; DFNB89; KARS; KARS2; KRS; LEPID
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200311 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCGTGCAGGCGGCCGAGGTGAAAGTGGATGGCAGCGAGCCGAAACTGAGCAAGAATGAGCTGA
AGAGACGCCTGAAAGCTGAGAAGAAAGTAGCAGAGAAGGAGGCCAAACAGAAGGAGCTCAGTGAGAAACA
GCTAAGCCAAGCCACTGCTGCTGCCACCAACCACACCACTGATAATGGTGTGGGTCCTGAGGAAGAGAGC
GTGGACCCAAATCAATACTACAAAATCCGCAGTCAAGCAATTCATCAGCTGAAGGTCAATGGGGAAGACC
CATACCCACACAAGTTCCATGTAGACATCTCACTCACTGACTTCATCCAAAAATATAGTCACCTGCAGCC
TGGGGATCACCTGACTGACATCACCTTAAAGGTGGCAGGTAGGATCCATGCCAAAAGAGCTTCTGGGGGA
AAGCTCATCTTCTATGATCTTCGAGGAGAGGGGGTGAAGTTGCAAGTCATGGCCAATTCCAGAAATTATA
AATCAGAAGAAGAATTTATTCATATTAATAACAAACTGCGTCGGGGAGACATAATTGGAGTTCAGGGGAA
TCCTGGTAAAACCAAGAAGGGTGAGCTGAGCATCATTCCGTATGAGATCACACTGCTGTCTCCCTGTTTG
CATATGTTACCTCATCTTCACTTTGGCCTCAAAGACAAGGAAACAAGGTATCGCCAGAGATACTTGGACT
TGATCCTGAATGACTTTGTGAGGCAGAAATTTATCATCCGCTCTAAGATCATCACATATATAAGAAGTTT
CTTAGATGAGCTGGGATTCCTAGAGATTGAAACTCCCATGATGAACATCATCCCAGGGGGAGCCGTGGCC
AAGCCTTTCATCACTTATCACAACGAGCTGGACATGAACTTATATATGAGAATTGCTCCAGAACTCTATC
ATAAGATGCTTGTGGTTGGTGGCATCGACCGGGTTTATGAAATTGGACGCCAGTTCCGGAATGAGGGGAT
TGATTTGACGCACAATCCTGAGTTCACCACCTGTGAGTTCTACATGGCCTATGCAGACTATCACGATCTC
ATGGAAATCACGGAGAAGATGGTTTCAGGGATGGTGAAGCATATTACAGGCAGTTACAAGGTCACCTACC
ACCCAGATGGCCCAGAGGGCCAAGCCTACGATGTTGACTTCACCCCACCCTTCCGGCGAATCAACATGGT
AGAAGAGCTTGAGAAAGCCCTGGGGATGAAGCTGCCAGAAACGAACCTCTTTGAAACTGAAGAAACTCGC
AAAATTCTTGATGATATCTGTGTGGCAAAAGCTGTTGAATGCCCTCCACCTCGGACCACAGCCAGGCTCC
TTGACAAGCTTGTTGGGGAGTTCCTGGAAGTGACTTGCATCAATCCTACATTCATCTGTGATCACCCACA
GATAATGAGCCCTTTGGCTAAATGGCACCGCTCTAAAGAGGGTCTGACTGAGCGCTTTGAGCTGTTTGTC
ATGAAGAAAGAGATATGCAATGCGTATACTGAGCTGAATGATCCCATGCGGCAGCGGCAGCTTTTTGAAG
AACAGGCCAAGGCCAAGGCTGCAGGTGATGATGAGGCCATGTTCATAGATGAAAACTTCTGTACTGCCCT
GGAATATGGGCTGCCCCCCACAGCTGGCTGGGGCATGGGCATTGATCGAGTCGCCATGTTTCTCACGGAC
TCCAACAACATCAAGGAAGTACTTCTGTTTCCTGCCATGAAACCCGAAGACAAGAAGGAGAATGTAGCAA
CCACTGATACACTGGAAAGCACAACAGTTGGCACTTCTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200311 protein sequence
Red=Cloning site Green=Tags(s)

MAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTTDNGVGPEEES
VDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGG
KLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCL
HMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVA
KPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDL
MEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETR
KILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFV
MKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTD
SNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005548
ORF Size 1791 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005548.3
RefSeq Size 2017 bp
RefSeq ORF 1794 bp
Locus ID 3735
UniProt ID Q15046
Cytogenetics 16q23.1
Domains tRNA-synt_2, tRNA_anti
Protein Pathways Aminoacyl-tRNA biosynthesis
MW 68 kDa
Gene Summary Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.