WDR1 (NM_017491) Human Tagged ORF Clone

CAT#: RC200303

Reviews ()
Write a review

WDR1 (Myc-DDK-tagged)-Human WD repeat domain 1 (WDR1), transcript variant 1



Reconstitution Protocol

USD 564.00

USD 846.00

In Stock*

Size
    • 10 ug

Product images

Other products for "WDR1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol WDR1
Synonyms AIP1; HEL-S-52; NORI-1; PFITS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200303 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGTACGAGATCAAGAAGGTGTTCGCCAGCCTCCCGCAGGTGGAGAGGGGCGTCTCCAAGATCATCG
GCGGCGACCCTAAGGGCAACAATTTTCTGTACACCAATGGAAAGTGCGTCATCCTAAGGAACATCGACAA
CCCAGCCCTTGCTGACATCTACACAGAGCACGCCCATCAGGTGGTGGTGGCCAAGTATGCGCCCAGCGGA
TTCTACATTGCCTCCGGAGATGTGTCTGGGAAGCTGAGGATCTGGGATACCACGCAGAAGGAGCACCTGT
TGAAGTATGAGTACCAGCCTTTCGCTGGGAAGATCAAAGACATTGCTTGGACTGAAGACAGTAAGAGGAT
CGCCGTGGTCGGGGAAGGAAGGGAGAAGTTTGGAGCAGTCTTCCTCTGGGATAGTGGCTCTTCTGTGGGC
GAGATTACAGGACACAACAAAGTCATCAACAGCGTGGACATCAAGCAGAGCCGGCCATACCGGCTGGCCA
CGGGAAGCGATGATAACTGCGCGGCATTCTTTGAGGGACCCCCATTCAAGTTCAAGTTCACAATTGGCGA
CCACAGCCGCTTTGTCAACTGTGTGCGATTCTCTCCTGATGGGAACAGATTTGCCACAGCCAGTGCTGAC
GGCCAGATATACATCTATGACGGGAAGACTGGGGAGAAGGTGTGCGCGCTGGGCGGAAGCAAGGCCCACG
ACGGTGGGATTTACGCAATTAGTTGGAGTCCCGACAGCACCCATTTGCTTTCTGCTTCTGGGGACAAAAC
TTCCAAGATTTGGGACGTCAGCGTGAACTCCGTGGTCAGCACATTTCCCATGGGCTCCACGGTTCTGGAC
CAGCAGCTGGGCTGCCTATGGCAGAAGGACCACCTGCTCAGTGTCTCCCTGTCCGGGTACATCAACTATC
TGGACAGAAACAACCCCAGCAAGCCCCTGCACGTCATCAAGGGTCACAGTAAATCGATCCAGTGTCTGAC
GGTGCATAAAAACGGCGGCAAGTCCTACATTTACTCTGGGAGCCACGACGGACACATTAATTACTGGGAT
TCAGAGACGGGGGAGAACGACTCCTTCGCTGGGAAAGGCCACACGAACCAGGTGTCCAGGATGACCGTGG
ATGAGTCGGGGCAGCTCATCAGCTGCAGCATGGACGACACCGTGCGGTACACCAGCCTCATGCTGCGGGA
CTACAGCGGACAAGGAGTTGTGAAACTGGACGTTCAGCCAAAGTGCGTAGCCGTCGGCCCCGGGGGATAC
GCCGTGGTCGTGTGCATTGGACAGATTGTCCTGCTGAAGGATCAGAGGAAGTGCTTCAGCATCGACAACC
CCGGCTACGAGCCCGAAGTTGTGGCAGTGCACCCCGGCGGGGACACGGTGGCAATTGGGGGTGTGGACGG
CAACGTCCGCCTGTATTCCATCCTGGGCACCACGTTGAAGGATGAGGGCAAGCTCCTAGAGGCCAAGGGC
CCCGTGACCGACGTGGCCTACTCCCACGACGGCGCCTTCCTCGCGGTGTGCGACGCCAGCAAGGTGGTCA
CAGTGTTCAGCGTTGCTGACGGCTACTCGGAGAACAATGTTTTTTATGGACACCATGCAAAAATCGTCTG
CCTGGCCTGGTCCCCAGACAATGAACACTTTGCCTCCGGTGGCATGGACATGATGGTGTATGTTTGGACC
CTGAGTGACCCGGAAACCAGAGTCAAGATCCAAGATGCACACCGGCTGCACCATGTCAGCAGCCTGGCCT
GGCTGGACGAGCACACGCTGGTCACGACCTCCCATGATGCCTCTGTCAAGGAGTGGACAATCACCTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200303 protein sequence
Red=Cloning site Green=Tags(s)

MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSG
FYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVG
EITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASAD
GQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLD
QQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWD
SETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGY
AVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKG
PVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWT
LSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTITY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017491
ORF Size 1818 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_017491.5
RefSeq Size 3160 bp
RefSeq ORF 1821 bp
Locus ID 9948
UniProt ID O75083
Cytogenetics 4p16.1
Domains WD40
MW 66.2 kDa
Gene Summary This gene encodes a protein containing 9 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WD domains are involved in protein-protein interactions. The encoded protein may help induce the disassembly of actin filaments. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.