CLPP (NM_006012) Human Tagged ORF Clone

CAT#: RC200301

CLPP (Myc-DDK-tagged)-Human ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli) (CLPP), nuclear gene encoding mitochondrial protein

Clone Modification / Custom Cloning Service

USD 98.00

USD 470.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CLPP (NM_006012) Human Tagged ORF Clone
Symbol CLPP
Synonyms DFNB81; PRLTS3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200301 representing NM_006012
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCCCGGAATATTGGTAGGGGGGGCCCGGGTGGCGTCATGCAGGTACCCCGCGCTGGGGCCTCGCC
TCGCCGCTCACTTTCCAGCGCAGCGGCCGCCGCAGCGGACACTCCAGAACGGCCTGGCCCTGCAGCGGTG
CCTGCACGCGACGGCGACCCGGGCTCTCCCGCTCATTCCCATCGTGGTGGAGCAGACGGGTCGCGGCGAG
CGCGCCTATGACATCTACTCGCGGCTGCTGCGGGAGCGCATCGTGTGCGTCATGGGCCCGATCGATGACA
GCGTTGCCAGCCTTGTTATCGCACAGCTCCTCTTCCTGCAATCCGAGAGCAACAAGAAGCCCATCCACAT
GTACATCAACAGCCCTGGTGGTGTGGTGACCGCGGGCCTGGCCATCTACGACACGATGCAGTACATCCTC
AACCCGATCTGCACCTGGTGCGTGGGCCAGGCCGCCAGCATGGGCTCCCTGCTTCTCGCCGCCGGCACCC
CAGGCATGCGCCACTCGCTCCCCAACTCCCGTATCATGATCCACCAGCCCTCAGGAGGCGCCCGGGGCCA
AGCCACAGACATTGCCATCCAGGCAGAGGAGATCATGAAGCTCAAGAAGCAGCTCTATAACATCTACGCC
AAGCACACCAAACAGAGCCTGCAGGTGATCGAGTCCGCCATGGAGAGGGACCGCTACATGAGCCCCATGG
AGGCCCAGGAGTTTGGCATCTTAGACAAGGTTCTGGTCCACCCTCCCCAGGACGGTGAGGATGAGCCCAC
GCTGGTGCAGAAGGAGCCTGTAGAAGCAGCGCCGGCAGCAGAACCTGTCCCAGCTAGCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200301 representing NM_006012
Red=Cloning site Green=Tags(s)

MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGE
RAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYIL
NPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYA
KHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006012
ORF Size 831 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006012.1, NM_006012.2, NP_006003
RefSeq Size 1194
RefSeq ORF 834
Locus ID 8192
Cytogenetics 19p13.3
Domains CLP_protease
Protein Families Protease, Druggable Genome
MW 30.18 kDa
Gene Summary The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)