ATG4B (NM_013325) Human Tagged ORF Clone

CAT#: RC200289

Reviews ()
Write a review

ATG4B (Myc-DDK-tagged)-Human ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 1



  "NM_013325" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ATG4B (NM_013325) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ATG4B
Synonyms APG4B; AUTL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200289 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCAGCTACTCTGACCTACGACACTCTCCGGTTTGCTGAGTTTGAAGATTTTCCTGAGACCTCAG
AGCCCGTTTGGATACTGGGTAGAAAATACAGCATTTTCACAGAAAAGGACGAGATCTTGTCTGATGTGGC
ATCTAGACTTTGGTTTACATACAGGAAAAACTTTCCAGCCATTGGGGGGACAGGCCCCACCTCGGACACA
GGCTGGGGCTGCATGCTGCGGTGTGGACAGATGATCTTTGCCCAAGCCCTGGTGTGCCGGCACCTAGGCC
GAGATTGGAGGTGGACACAAAGGAAGAGGCAGCCAGACAGCTACTTCAGCGTCCTCAACGCATTCATCGA
CAGGAAGGACAGTTACTACTCCATTCACCAGATAGCGCAAATGGGAGTTGGCGAAGGCAAGTCCATAGGC
CAGTGGTACGGGCCCAACACTGTCGCCCAGGTCCTGAAGAAGCTTGCTGTCTTCGATACGTGGAGCTCCT
TGGCGGTCCACATTGCAATGGACAACACTGTTGTGATGGAGGAAATCAGAAGGTTGTGCAGGACCAGCGT
TCCCTGTGCAGGCGCCACTGCGTTTCCTGCAGATTCCGACCGGCACTGCAACGGATTCCCTGCCGGAGCT
GAGGTCACCAACAGGCCGTCGCCATGGAGACCCCTGGTACTTCTCATTCCCCTGCGCCTGGGGCTCACGG
ACATCAACGAGGCCTACGTGGAGACGCTGAAGCACTGCTTCATGATGCCCCAGTCCCTGGGCGTCATCGG
AGGGAAGCCCAACAGCGCCCACTACTTCATCGGCTACGTTGGTGAGGAGCTCATCTACCTGGACCCCCAC
ACCACGCAGCCAGCCGTGGAGCCCACTGATGGCTGCTTCATCCCGGACGAGAGCTTCCACTGCCAGCACC
CGCCGTGCCGCATGAGCATCGCGGAGCTTGACCCGTCCATCGCTGTGGGGTTTTTCTGTAAGACTGAAGA
TGACTTCAATGATTGGTGCCAGCAAGTCAAAAAGCTGTCTCTGCTCGGAGGTGCCCTGCCCATGTTTGAG
CTGGTGGAGCAGCAGCCTTCACATCTGGCCTGCCCCGACGTCCTGAACCTGTCCCTAGATTCTTCTGATG
TAGAGCGACTGGAAAGATTCTTCGACTCAGAAGATGAAGACTTTGAAATCCTGTCCCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200289 protein sequence
Red=Cloning site Green=Tags(s)

MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDT
GWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIG
QWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGA
EVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPH
TTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFE
LVEQQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_013325
ORF Size 1179 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013325.2, NM_013325.3, NM_013325.4, NP_037457.3
RefSeq Size 2892 bp
RefSeq ORF 1182 bp
Locus ID 23192
Cytogenetics 2q37.3
Domains Peptidase_C54
Protein Families Protease
Protein Pathways Regulation of autophagy
MW 44.3 kDa
Gene Summary Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "ATG4B"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ATG4B mouse monoclonal antibody,clone OTI1A3
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools