ATG4B (NM_013325) Human Tagged ORF Clone

CAT#: RC200289

ATG4B (Myc-DDK-tagged)-Human ATG4 autophagy related 4 homolog B (S. cerevisiae) (ATG4B), transcript variant 1

Clone Modification / Custom Cloning Service

USD 495.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ATG4B (NM_013325) Human Tagged ORF Clone
Symbol ATG4B
Synonyms APG4B; AUTL1
Vector pCMV6-Entry
Sequence Data
>RC200289 representing NM_013325
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCAGCTACTCTGACCTACGACACTCTCCGGTTTGCTGAGTTTGAAGATTTTCCTGAGACCTCAG
AGCCCGTTTGGATACTGGGTAGAAAATACAGCATTTTCACAGAAAAGGACGAGATCTTGTCTGATGTGGC
ATCTAGACTTTGGTTTACATACAGGAAAAACTTTCCAGCCATTGGGGGGACAGGCCCCACCTCGGACACA
GGCTGGGGCTGCATGCTGCGGTGTGGACAGATGATCTTTGCCCAAGCCCTGGTGTGCCGGCACCTAGGCC
GAGATTGGAGGTGGACACAAAGGAAGAGGCAGCCAGACAGCTACTTCAGCGTCCTCAACGCATTCATCGA
CAGGAAGGACAGTTACTACTCCATTCACCAGATAGCGCAAATGGGAGTTGGCGAAGGCAAGTCCATAGGC
CAGTGGTACGGGCCCAACACTGTCGCCCAGGTCCTGAAGAAGCTTGCTGTCTTCGATACGTGGAGCTCCT
TGGCGGTCCACATTGCAATGGACAACACTGTTGTGATGGAGGAAATCAGAAGGTTGTGCAGGACCAGCGT
TCCCTGTGCAGGCGCCACTGCGTTTCCTGCAGATTCCGACCGGCACTGCAACGGATTCCCTGCCGGAGCT
GAGGTCACCAACAGGCCGTCGCCATGGAGACCCCTGGTACTTCTCATTCCCCTGCGCCTGGGGCTCACGG
ACATCAACGAGGCCTACGTGGAGACGCTGAAGCACTGCTTCATGATGCCCCAGTCCCTGGGCGTCATCGG
AGGGAAGCCCAACAGCGCCCACTACTTCATCGGCTACGTTGGTGAGGAGCTCATCTACCTGGACCCCCAC
ACCACGCAGCCAGCCGTGGAGCCCACTGATGGCTGCTTCATCCCGGACGAGAGCTTCCACTGCCAGCACC
CGCCGTGCCGCATGAGCATCGCGGAGCTTGACCCGTCCATCGCTGTGGGGTTTTTCTGTAAGACTGAAGA
TGACTTCAATGATTGGTGCCAGCAAGTCAAAAAGCTGTCTCTGCTCGGAGGTGCCCTGCCCATGTTTGAG
CTGGTGGAGCAGCAGCCTTCACATCTGGCCTGCCCCGACGTCCTGAACCTGTCCCTAGATTCTTCTGATG
TAGAGCGACTGGAAAGATTCTTCGACTCAGAAGATGAAGACTTTGAAATCCTGTCCCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200289 representing NM_013325
Red=Cloning site Green=Tags(s)

MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDT
GWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIG
QWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGA
EVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPH
TTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFE
LVEQQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_013325
ORF Size 1179 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013325.2, NM_013325.3, NM_013325.4, NP_037457
RefSeq Size 2892
RefSeq ORF 1182
Locus ID 23192
Cytogenetics 2q37.3
Domains Peptidase_C54
Protein Families Protease
Protein Pathways Regulation of autophagy
MW 44.1 kDa
Gene Summary Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)