LSM1 (NM_014462) Human Tagged ORF Clone

CAT#: RC200288

LSM1 (Myc-DDK-tagged)-Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1)

Product Images

Circular map for RC200288

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY LSM1 (Cat# RC200288, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-LSM1(Cat# TA503120). Positive lysates LY415265 (100ug) and LC415265 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY415265) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200288 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified LSM1 protein (Cat# TP300288). The protein was produced from HEK293T cells transfected with LSM1 cDNA clone (Cat# RC200288) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: LSM1
• Synonyms: CASM; YJL124C
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200288 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAACTATATGCCTGGCACCGCCAGCCTCATCGAGGACATTGACAAAAAGCACTTGGTTCTGCTTCGAG
  ATGGAAGGACACTTATAGGCTTTTTAAGAAGCATTGATCAATTTGCAAACTTAGTGCTACATCAGACTGT
  GGAGCGTATTCATGTGGGCAAAAAATACGGTGATATTCCTCGAGGGATTTTTGTGGTCAGAGGAGAAAAT
  GTGGTCCTACTAGGAGAAATAGACTTGGAAAAGGAGAGTGACACACCCCTCCAGCAAGTATCCATTGAAG
  AAATTCTAGAAGAACAAAGGGTGGAACAGCAGACCAAGCTGGAAGCAGAGAAGTTGAAAGTGCAGGCCCT
  GAAGGACCGAGGTCTTTCCATTCCTCGAGCAGATACTCTTGATGAGTAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200288 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN
  VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_014462
• ORF Size: 399 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_014462.3
• RefSeq Size: 1161 bp
• RefSeq ORF: 402 bp
• Locus ID: 27257
• UniProt ID: O15116
• Cytogenetics: 8p11.23
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation
• MW: 15.2 kDa
• Gene Summary: This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Nov 2011]