RPC62 (POLR3C) (NM_006468) Human Tagged ORF Clone

CAT#: RC200279

POLR3C (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide C (62kD) (POLR3C)



  "NM_006468" in other vectors (6)

Reconstitution Protocol

USD 497.00

USD 745.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "POLR3C"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol POLR3C
Synonyms C82; RPC3; RPC62
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200279 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTCAAGCAGAAATTAAGCTCTGTTCTTTGTTGCTGCAAGAGCATTTTGGAGAGATTGTAGAAAAAA
TTGGAGTCCATCTGATAAGAACCGGCAGCCAGCCACTAAGAGTAATTGCCCATGACACAGGAACATCACT
GGATCAGGTGAAGAAAGCCCTGTGTGTCCTCGTCCAACATAACCTGGTGAGTTATCAAGTGCACAAACGT
GGTGTGGTGGAGTATGAAGCCCAGTGCAGCCGGGTATTGCGAATGCTTAGATATCCCCGGTACATCTATA
CTACCAAAACTCTGTACAGTGACACTGGAGAGCTGATTGTTGAGGAGCTTCTGTTGAACGGCAAACTGAC
AATGTCAGCTGTTGTGAAGAAAGTGGCAGACCGGCTCACAGAGACCATGGAGGATGGCAAGACCATGGAC
TATGCTGAAGTATCAAACACATTTGTGCGACTGGCAGACACACACTTTGTACAACGCTGCCCTTCGGTAC
CTACCACTGAGAATTCAGACCCTGGGCCACCACCACCTGCCCCCACACTTGTCATTAATGAAAAGGACAT
GTACCTGGTTCCTAAACTCAGCTTGATAGGGAAAGGTAAAAGGAGGAGATCATCTGATGAAGATGCTGCT
GGGGAGCCCAAGGCCAAGAGACCAAAATATACTACAGATAACAAGGAGCCCATTCCAGATGATGGGATTT
ATTGGCAGGCCAACCTTGACAGATTCCACCAACACTTCCGTGACCAAGCCATTGTGAGCGCAGTTGCTAA
CAGGATGGACCAGACAAGCAGCGAGATTGTGCGAACCATGCTCCGAATGAGTGAGATTACCACTTCCTCT
AGTGCTCCCTTCACCCAGCCATTGTCTTCCAATGAGATCTTCAGATCCCTACCTGTTGGCTATAACATCT
CTAAGCAAGTTCTTGATCAGTATCTCACTCTGCTGGCAGATGATCCACTAGAGTTTGTTGGAAAGTCTGG
CGACAGTGGTGGAGGAATGTATGTCATCAACCTCCATAAGGCATTAGCATCCCTAGCCACAGCCACTCTG
GAGTCCGTCGTACAGGAGAGATTTGGGTCTCGCTGTGCTAGAATATTCCGTCTAGTTTTGCAGAAGAAAC
ACATAGAGCAGAAGCAAGTGGAAGACTTTGCAATGATTCCTGCAAAGGAGGCAAAGGATATGCTATATAA
GATGCTCTCAGAAAATTTCATGTCACTCCAGGAAATTCCCAAAACACCAGACCATGCCCCATCCAGGACC
TTCTATTTATATACTGTGAACATCCTGTCAGCTGCCCGAATGTTGTTGCACAGGTGCTACAAGAGCATAG
CCAACTTGATAGAAAGGAGGCAATTTGAAACCAAAGAGAATAAGCGTCTACTAGAAAAATCTCAGAGGGT
AGAAGCCATCATTGCATCTATGCAGGCTACTGGTGCAGAGGAAGCACAGTTACAAGAAATAGAGGAGATG
ATCACAGCTCCTGAACGTCAGCAGCTAGAGACCCTGAAACGTAATGTCAACAAGTTGGATGCCAGTGAGA
TCCAGGTGGACGAAACCATCTTCCTGCTGGAGTCTTACATTGAGTGCACCATGAAGAGACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200279 protein sequence
Red=Cloning site Green=Tags(s)

MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKR
GVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETMEDGKTMD
YAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAA
GEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSS
SAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATL
ESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT
FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAEEAQLQEIEEM
ITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006468
ORF Size 1602 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006468.8
RefSeq Size 1888 bp
RefSeq ORF 1605 bp
Locus ID 10623
UniProt ID Q9BUI4
Cytogenetics 1q21.1
Protein Families Transcription Factors
Protein Pathways Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
MW 60.6 kDa
Gene Summary DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. May direct with other members of the subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. May be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. Preferentially binds single-stranded DNA (ssDNA) in a sequence-independent manner (PubMed:21358628).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.