RPC62(POLR3C) (NM_006468) Human Tagged ORF Clone

CAT#: RC200279

POLR3C (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide C (62kD) (POLR3C)

  View "NM_006468" in other vectors (10)

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name RPC62(POLR3C) (NM_006468) Human Tagged ORF Clone
Symbol POLR3C
Synonyms RPC3; RPC62
Vector pCMV6-Entry
Sequence Data
>RC200279 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTCAAGCAGAAATTAAGCTCTGTTCTTTGTTGCTGCAAGAGCATTTTGGAGAGATTGTAGAAAAAA
TTGGAGTCCATCTGATAAGAACCGGCAGCCAGCCACTAAGAGTAATTGCCCATGACACAGGAACATCACT
GGATCAGGTGAAGAAAGCCCTGTGTGTCCTCGTCCAACATAACCTGGTGAGTTATCAAGTGCACAAACGT
GGTGTGGTGGAGTATGAAGCCCAGTGCAGCCGGGTATTGCGAATGCTTAGATATCCCCGGTACATCTATA
CTACCAAAACTCTGTACAGTGACACTGGAGAGCTGATTGTTGAGGAGCTTCTGTTGAACGGCAAACTGAC
AATGTCAGCTGTTGTGAAGAAAGTGGCAGACCGGCTCACAGAGACCATGGAGGATGGCAAGACCATGGAC
TATGCTGAAGTATCAAACACATTTGTGCGACTGGCAGACACACACTTTGTACAACGCTGCCCTTCGGTAC
CTACCACTGAGAATTCAGACCCTGGGCCACCACCACCTGCCCCCACACTTGTCATTAATGAAAAGGACAT
GTACCTGGTTCCTAAACTCAGCTTGATAGGGAAAGGTAAAAGGAGGAGATCATCTGATGAAGATGCTGCT
GGGGAGCCCAAGGCCAAGAGACCAAAATATACTACAGATAACAAGGAGCCCATTCCAGATGATGGGATTT
ATTGGCAGGCCAACCTTGACAGATTCCACCAACACTTCCGTGACCAAGCCATTGTGAGCGCAGTTGCTAA
CAGGATGGACCAGACAAGCAGCGAGATTGTGCGAACCATGCTCCGAATGAGTGAGATTACCACTTCCTCT
AGTGCTCCCTTCACCCAGCCATTGTCTTCCAATGAGATCTTCAGATCCCTACCTGTTGGCTATAACATCT
CTAAGCAAGTTCTTGATCAGTATCTCACTCTGCTGGCAGATGATCCACTAGAGTTTGTTGGAAAGTCTGG
CGACAGTGGTGGAGGAATGTATGTCATCAACCTCCATAAGGCATTAGCATCCCTAGCCACAGCCACTCTG
GAGTCCGTCGTACAGGAGAGATTTGGGTCTCGCTGTGCTAGAATATTCCGTCTAGTTTTGCAGAAGAAAC
ACATAGAGCAGAAGCAAGTGGAAGACTTTGCAATGATTCCTGCAAAGGAGGCAAAGGATATGCTATATAA
GATGCTCTCAGAAAATTTCATGTCACTCCAGGAAATTCCCAAAACACCAGACCATGCCCCATCCAGGACC
TTCTATTTATATACTGTGAACATCCTGTCAGCTGCCCGAATGTTGTTGCACAGGTGCTACAAGAGCATAG
CCAACTTGATAGAAAGGAGGCAATTTGAAACCAAAGAGAATAAGCGTCTACTAGAAAAATCTCAGAGGGT
AGAAGCCATCATTGCATCTATGCAGGCTACTGGTGCAGAGGAAGCACAGTTACAAGAAATAGAGGAGATG
ATCACAGCTCCTGAACGTCAGCAGCTAGAGACCCTGAAACGTAATGTCAACAAGTTGGATGCCAGTGAGA
TCCAGGTGGACGAAACCATCTTCCTGCTGGAGTCTTACATTGAGTGCACCATGAAGAGACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200279 protein sequence
Red=Cloning site Green=Tags(s)

MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKR
GVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETMEDGKTMD
YAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAA
GEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSS
SAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATL
ESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT
FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAEEAQLQEIEEM
ITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006468
ORF Size 1605 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006468.2, NM_006468.3, NM_006468.4, NM_006468.5, NM_006468.6, NM_006468.7, NP_006459
RefSeq Size 1888
RefSeq ORF 1605
Locus ID 10623
Cytogenetics 1q21.1
Protein Families Transcription Factors
Protein Pathways Purine metabolism, Pyrimidine metabolism, Metabolic pathways, RNA polymerase, Cytosolic DNA-sensing pathway
MW 60.6 kDa

Other Versions

Other products for "POLR3C"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


POLR3C (RPC62) mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
    • 100 ul

USD 379.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones