HSP70-1A (HSPA1A) (NM_005345) Human Tagged ORF Clone

CAT#: RC200270

Reviews ()
Write a review

HSPA1A (Myc-DDK-tagged)-Human heat shock 70kDa protein 1A (HSPA1A)



  "NM_005345" in other vectors (7)

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name HSP70-1A (HSPA1A) (NM_005345) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HSPA1A
Synonyms HEL-S-103; HSP70-1; HSP70-1A; HSP70-2; HSP70.1; HSP70.2; HSP70I; HSP72; HSPA1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200270 representing NM_005345
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAAGCCGCGGCGATCGGCATCGACCTGGGCACCACCTACTCCTGCGTGGGGGTGTTCCAACACG
GCAAGGTGGAGATCATCGCCAACGACCAGGGCAACCGCACCACCCCCAGCTACGTGGCCTTCACGGACAC
CGAGCGGCTCATCGGGGATGCGGCCAAGAACCAGGTGGCGCTGAACCCGCAGAACACCGTGTTTGACGCG
AAGCGGCTGATCGGCCGCAAGTTCGGCGACCCGGTGGTGCAGTCGGACATGAAGCACTGGCCTTTCCAGG
TGATCAACGACGGAGACAAGCCCAAGGTGCAGGTGAGCTACAAGGGGGAGACCAAGGCATTCTACCCCGA
GGAGATCTCGTCCATGGTGCTGACCAAGATGAAGGAGATCGCCGAGGCGTACCTGGGCTACCCGGTGACC
AACGCGGTGATCACCGTGCCGGCCTACTTCAACGACTCGCAGCGCCAGGCCACCAAGGATGCGGGTGTGA
TCGCGGGGCTCAACGTGCTGCGGATCATCAACGAGCCCACGGCCGCCGCCATCGCCTACGGCCTGGACAG
AACGGGCAAGGGGGAGCGCAACGTGCTCATCTTTGACCTGGGCGGGGGCACCTTCGACGTGTCCATCCTG
ACGATCGACGACGGCATCTTCGAGGTGAAGGCCACGGCCGGGGACACCCACCTGGGTGGGGAGGACTTTG
ACAACAGGCTGGTGAACCACTTCGTGGAGGAGTTCAAGAGAAAACACAAGAAGGACATCAGCCAGAACAA
GCGAGCCGTGAGGCGGCTGCGCACCGCCTGCGAGAGGGCCAAGAGGACCCTGTCGTCCAGCACCCAGGCC
AGCCTGGAGATCGACTCCCTGTTTGAGGGCATCGACTTCTACACGTCCATCACCAGGGCGAGGTTCGAGG
AGCTGTGCTCCGACCTGTTCCGAAGCACCCTGGAGCCCGTGGAGAAGGCTCTGCGCGACGCCAAGCTGGA
CAAGGCCCAGATTCACGACCTGGTCCTGGTCGGGGGCTCCACCCGCATCCCCAAGGTGCAGAAGCTGCTG
CAGGACTTCTTCAACGGGCGCGACCTGAACAAGAGCATCAACCCCGACGAGGCTGTGGCCTACGGGGCGG
CGGTGCAGGCGGCCATCCTGATGGGGGACAAGTCCGAGAACGTGCAGGACCTGCTGCTGCTGGACGTGGC
TCCCCTGTCGCTGGGGCTGGAGACGGCCGGAGGCGTGATGACTGCCCTGATCAAGCGCAACTCCACCATC
CCCACCAAGCAGACGCAGATCTTCACCACCTACTCCGACAACCAACCCGGGGTGCTGATCCAGGTGTACG
AGGGCGAGAGGGCCATGACGAAAGACAACAATCTGTTGGGGCGCTTCGAGCTGAGCGGCATCCCTCCGGC
CCCCAGGGGCGTGCCCCAGATCGAGGTGACCTTCGACATCGATGCCAACGGCATCCTGAACGTCACGGCC
ACGGACAAGAGCACCGGCAAGGCCAACAAGATCACCATCACCAACGACAAGGGCCGCCTGAGCAAGGAGG
AGATCGAGCGCATGGTGCAGGAGGCGGAGAAGTACAAAGCGGAGGACGAGGTGCAGCGCGAGAGGGTGTC
AGCCAAGAACGCCCTGGAGTCCTACGCCTTCAACATGAAGAGCGCCGTGGAGGATGAGGGGCTCAAGGGC
AAGATCAGCGAGGCGGACAAGAAGAAGGTTCTGGACAAGTGTCAAGAGGTCATCTCGTGGCTGGACGCCA
ACACCTTGGCCGAGAAGGACGAGTTTGAGCACAAGAGGAAGGAGCTGGAGCAGGTGTGTAACCCCATCAT
CAGCGGACTGTACCAGGGTGCCGGTGGTCCCGGGCCTGGGGGCTTCGGGGCTCAGGGTCCCAAGGGAGGG
TCTGGGTCAGGCCCCACCATTGAGGAGGTGGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200270 representing NM_005345
Red=Cloning site Green=Tags(s)

MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDA
KRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVT
NAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSIL
TIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQA
SLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLL
QDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA
TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKG
KISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGG
SGSGPTIEEVD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005345
ORF Size 1923 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005345.3, NM_005345.4, NM_005345.5, NP_005336.2
RefSeq Size 2383 bp
RefSeq ORF 1926 bp
Locus ID 3303
Cytogenetics 6p21.33
Domains HSP70
Protein Pathways Antigen processing and presentation, Endocytosis, MAPK signaling pathway, Prion diseases, Spliceosome
MW 69.9 kDa
Gene Summary This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which encode similar proteins. [provided by RefSeq, Jul 2008]

Citations (5)

Other Versions

Other products for "HSPA1A"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Mouse monoclonal anti-HSPA1A(HSP70) antibody, clone 3C6, Loading, clone OTI3C6 (formerly 3C6)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools